Recombinant Pseudomonas fluorescens Cyclic di-GMP-binding protein (bcsB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Processes

The bcsB protein plays a crucial role in bacterial cellulose synthesis and biofilm formation, processes regulated by cyclic di-GMP signaling pathways. As part of the bacterial cellulose synthase complex, bcsB works in coordination with other proteins, particularly BcsA, which contains the catalytic domain responsible for cellulose polymerization. The binding of cyclic di-GMP to components of this complex activates cellulose production, contributing to the formation of robust biofilms.

In Pseudomonas fluorescens specifically, these mechanisms are particularly significant as the bacterium serves as an effective biocontrol agent for soil-borne fungal diseases . The ability of P. fluorescens to form biofilms on plant roots creates a protective barrier against pathogenic microorganisms, enhancing its effectiveness as a biological control agent. Studies have demonstrated that P. fluorescens pc78 exhibits significant biocontrol efficacy, suggesting that proteins involved in biofilm formation, such as bcsB, contribute to this beneficial trait .

The interaction between bcsB and cyclic di-GMP represents a critical regulatory mechanism in bacterial physiology. When cyclic di-GMP binds to bcsB and other components of the cellulose synthase complex, it triggers conformational changes that activate the cellulose synthesis machinery. This activation leads to the production of cellulose fibrils that form the structural backbone of bacterial biofilms, providing protection against environmental stressors and antimicrobial compounds.

Cyclic di-GMP Binding Mechanisms

Cyclic di-GMP (cyclic diguanylate monophosphate) functions as a universal bacterial second messenger that regulates numerous cellular processes, including biofilm formation, virulence, motility, and cell cycle progression. The interaction between cyclic di-GMP and its receptor proteins, including bcsB, represents a sophisticated signaling mechanism in bacterial cells.

Research on cyclic di-GMP binding mechanisms has revealed that most receptor proteins utilize specific amino acid residues, particularly arginine (Arg) and aspartate/glutamate (Asp/Glu), to bind cyclic di-GMP molecules . These interactions typically involve the formation of hydrogen bonds between these amino acid residues and the guanine bases of cyclic di-GMP. Specifically, arginine residues bind to the O-6 and N-7 atoms at the Hoogsteen edge of the guanine base, while aspartate/glutamate residues interact with the N-1 and N-2 atoms at the Watson-Crick edge .

The binding configurations can involve cyclic di-GMP monomers, dimers, or even tetramers with stacked guanine bases, depending on the specific receptor protein. Additionally, arginine residues often participate in stacking interactions with the guanine bases and aromatic rings of tyrosine and phenylalanine residues, further stabilizing the complex . This structural arrangement explains the consistent presence of arginine residues in the active sites of proteins that bind stacked cyclic di-GMP molecules.

Table 2: Common Features of Cyclic di-GMP Binding Proteins

FeatureDescription
Key binding residuesArginine, Aspartate/Glutamate
Binding configurationMonomers, dimers, or tetramers with stacked guanine bases
Arginine binding targetsO-6 and N-7 atoms at Hoogsteen edge of guanine
Asp/Glu binding targetsN-1 and N-2 atoms at Watson-Crick edge of guanine
Additional stabilizationStacking interactions between Arg, guanine bases, and aromatic amino acids

While the specific binding mechanism of P. fluorescens bcsB has not been fully characterized in the available literature, it likely follows similar patterns observed in other cyclic di-GMP receptor proteins. Further structural studies of the recombinant protein would provide more detailed insights into these interactions.

Relationship with the PilZ Domain

The PilZ domain represents one of the most well-characterized cyclic di-GMP binding motifs in bacterial proteins. Interestingly, this domain has been identified at the C-terminus of BcsA, the catalytic subunit of the bacterial cellulose synthase complex, aligning with the role of cyclic di-GMP as an activator of cellulose synthesis .

Earlier research had suggested that cyclic di-GMP binding occurred in BcsB, which appeared contradictory to findings about the PilZ domain in BcsA. This apparent discrepancy was resolved when it was discovered that in Komagataeibacter xylinus, the bcsA and bcsB genes are fused, encoding a single 1,500-amino acid BcsAB fusion protein containing the PilZ domain in the middle section . This arrangement explains how proteolytic digestion of the BcsAB fusion protein could leave the PilZ domain attached to the BcsB fragment, creating the impression that BcsB itself was binding cyclic di-GMP.

Environmental Impact and Microbial Ecology

Pseudomonas fluorescens serves as an effective biocontrol agent for soil-borne fungal diseases, making proteins involved in its beneficial activities particularly relevant for agricultural applications . Studies investigating the environmental impact of P. fluorescens have shown that its introduction into tomato rhizosphere influences the microbial community structure without posing significant environmental risks in terms of gene transfer .

Research on P. fluorescens pc78, a strain with effective biocontrol properties, demonstrated that while the bacterial treatment influenced the microbial community in tomato rhizosphere, there was no evidence of chromosomally integrated genes transferring to other organisms . Additionally, the population and colony types of culturable bacteria were not significantly affected by the introduction of P. fluorescens into the rhizosphere environment.

These findings suggest that proteins involved in P. fluorescens biofilm formation and root colonization, potentially including bcsB, contribute to its biocontrol efficacy without disrupting the broader microbial ecology. The environmental safety of using P. fluorescens as a biocontrol agent enhances its potential for sustainable agricultural applications.

Applications in Research and Biotechnology

Recombinant P. fluorescens bcsB protein serves as a valuable tool for various research and biotechnological applications. The availability of the purified recombinant protein enables detailed structural studies, including crystallography and other biophysical analyses, to elucidate the three-dimensional organization of bcsB and its interactions with cyclic di-GMP.

Functional characterization studies using the recombinant protein allow researchers to investigate the binding affinity and specificity of the bcsB-cyclic di-GMP interaction, providing insights into the regulatory mechanisms controlling bacterial cellulose synthesis. These studies contribute to our understanding of biofilm formation, a process with significant implications for both medical and environmental microbiology.

From a biotechnological perspective, understanding the function of bcsB and related proteins in P. fluorescens contributes to the development of novel biocontrol strategies for agricultural applications. The natural biocontrol properties of P. fluorescens could potentially be enhanced through targeted modifications of proteins involved in biofilm formation and plant root colonization.

Additionally, as bacterial biofilms contribute to antibiotic resistance and persistent infections, proteins involved in their formation, such as bcsB, represent potential targets for novel antimicrobial compounds. Structural insights gained from studying the recombinant protein could guide the design of inhibitors targeting cyclic di-GMP binding, offering new approaches to combat biofilm-associated infections.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a preferred tag type, please specify it, and we will prioritize its development.
Synonyms
bcsB; wssC; PFLU_0302; Cyclic di-GMP-binding protein; Cellulose synthase regulatory subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-755
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain SBW25)
Target Names
bcsB
Target Protein Sequence
MTSNIFARPHPRRALALMIASLMGFNTLAQAAEQAVATVPVQSTDTGYSLTLKQLGRRDT MNLQGVESSDSVNFDIRADEVVKGAQLLLKYSYSPALLADLSQINVLVNGEVAASLPLPK EGAGTPQEQLVQIPAHLITEFNRLSLQFIGHYTMSCEDPLHSSLWAKISNSSELKVQVEP IVLKDDLAVLPLPFFDKRDARQVSLPFVFATAPDSAALEAAGALSSWIGGLASYRGATFP TTLGELPAKGNAIVLVQTADAMDIHGVAVAKPAGPTLTLIANPNDANGKLLIVTGRDGAE LKRAANAVVLGNPVLAGNSVVITKLDTLAPRRPYDAPNWLPSNRPVRLGELIEQQKLSVS GYNPGAISVDMRLPPDLFNWREEGVPLKLKYRYTPQQVSTNSSLLIGLNDQFMKSVALPS VSNLGGGQTLLDQLKKDESLPREVTTLLPISSASPKSKLQVRFMYDYIKEGECRDIIVDN MRGSVDPDSTLDVTGYQHYIAMPNLGVFNDSGFPFTRLADLSESAVVMPDNYGTDELTAY LTVLGRFGEATGYPATAVKVVQAKDVQSVADKDLLVLATAANQPLLKQWQQYLPATSDGE QHQFLLSDLPRYVRSWISPDPAANQHPANTGITFKGLSNSTWLAGFQSPLKSGRSVVLIA SNQPQGLLEATNALIGGDDYKDSIQGSLAVVQGTQISSLVGDEQYYVGKLNYFKFMQWQL SQNLGWMLLITFLGLAVVTSLIYLSLRARAKRRLA
Uniprot No.

Target Background

Function
This protein binds the cellulose synthase activator, bis-(3'-5') cyclic diguanylic acid (c-di-GMP).
Database Links
Protein Families
AcsB/BcsB family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the role of cyclic di-GMP in bcsB function?

Cyclic di-GMP (c-di-GMP) serves as a bacterial signaling molecule that activates the BcsA-B complex. Mechanistically, c-di-GMP binding releases an auto-inhibited state of the cellulose synthase enzyme by breaking a salt bridge that otherwise tethers a conserved gating loop controlling access to the active site . When c-di-GMP binds to the BcsA-B complex, it causes conformational changes that allow for:

  • Opening of the catalytic pocket

  • Coordination of UDP-glucose at the active site

  • Movement of a "finger helix" that interacts with the growing cellulose polymer

  • Translocation of cellulose into the transmembrane channel

This activation mechanism demonstrates how c-di-GMP serves as an allosteric regulator of bacterial cellulose synthesis .

How does bcsB contribute to biofilm formation?

BcsB plays a crucial role in biofilm formation through its participation in cellulose synthesis. High cellular levels of cyclic di-GMP promote sessility, biofilm formation, and aggregative behavior in bacteria . The BcsA-B complex, when activated by c-di-GMP, synthesizes cellulose, which is a major structural component of bacterial biofilms . The production of cellulose provides physical structure and protection to bacterial communities, contributing to biofilm integrity and antibiotic resistance . Mutations in bcsB or alterations in its ability to respond to c-di-GMP would likely impact biofilm architecture and stability, making it a potential target for anti-biofilm strategies.

Experimental Methods for bcsB Research

Two primary purification strategies have been documented for bcsB:

  • For His-tagged bcsB: Immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography yields purity greater than 90% as determined by SDS-PAGE .

  • For LARD-fused bcsB: Hydrophobic interaction chromatography (HIC) using a methyl-Sepharose column takes advantage of the hydrophobic C-terminus of the LARD fusion. This method has been shown to purify some proteins to almost a single product .

Post-purification, the protein can be supplied in either liquid form or as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For long-term storage, reconstitution to 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C is recommended .

What experimental designs are most suitable for studying bcsB function?

When investigating bcsB function, several experimental designs can be employed:

Experimental DesignApplicationAdvantagesConsiderations
A-B DesignInitial assessment of bcsB contribution to phenotypesSimple implementationLimited causal inference
Reversal Design (A-B-A)Testing effects of bcsB mutationsDemonstrates experimental controlEthical concerns if phenotype is harmful
Multiple Baseline DesignTesting bcsB function across multiple conditionsNo withdrawal neededMay be difficult to demonstrate control
Alternating Treatment DesignComparing multiple bcsB variantsRapid testing of multiple variablesPotential for multiple treatment effect

The choice of experimental design should be guided by your specific research question. For example, A-B designs are suitable for initial assessments, while reversal designs provide stronger evidence of causality but may not be feasible if the effects of bcsB manipulation cannot be reversed .

What is the molecular mechanism of c-di-GMP binding to the BcsA-B complex?

The crystal structures of the c-di-GMP-activated BcsA-B complex reveal sophisticated molecular interactions. BcsA's C-terminal PilZ domain binds an intercalated c-di-GMP dimer . The binding mechanism involves:

  • One c-di-GMP molecule (c-di-GMP-A) interacts with the "DxSxxG" motif on the β-barrel surface

  • The second molecule (c-di-GMP-B) is stabilized by π–π stacking interactions with c-di-GMP-A and residues within the TM8-β-barrel linker

  • Guanine bases of the c-di-GMP dimer stack parallel to the β-barrel surface and perpendicular to the TM8-β-barrel linker

In c-di-GMP binding signature motifs:

  • Arg residues bind to the O-6 and N-7 atoms at the Hoogsteen edge of the guanine base

  • Asp/Glu residues bind the N-1 and N-2 atoms at the Watson-Crick edge

  • Arg residues participate in stacking interactions with the guanine bases of c-di-GMP and the aromatic rings of Tyr and Phe residues

This binding mechanism explains the presence of Arg residues in the active sites of every receptor protein that binds stacked c-di-GMP.

How can site-directed mutagenesis be utilized to study bcsB function?

Site-directed mutagenesis represents a powerful approach for investigating bcsB structure-function relationships. Strategic targets include:

  • Salt bridge disruption: Mutating residues involved in the regulatory salt bridge can generate a constitutively active cellulose synthase, allowing researchers to study the consequences of unregulated cellulose production .

  • c-di-GMP binding residues: Targeting the conserved Arg and Asp/Glu residues that participate in c-di-GMP binding can help elucidate the specificity and affinity of this interaction .

  • Interface residues: Mutations at the BcsA-BcsB interface can reveal the structural basis of subunit interactions and their role in cellulose synthesis and translocation.

A systematic mutagenesis approach should follow this methodology:

  • Identify conserved residues through sequence alignment

  • Generate single and combinatorial mutations

  • Express and purify mutant proteins

  • Assess structural integrity through biophysical methods

  • Evaluate functional consequences through activity assays and binding studies

  • Validate findings through complementation of knockout strains

How does the BcsA-B complex coordinate cellulose synthesis and membrane translocation?

The BcsA-B complex performs the dual function of synthesizing cellulose and translocating it across the inner membrane. Crystal structures reveal that:

  • The complex contains a nascent cellulose polymer whose terminal glucose unit positions above BcsA's active site where catalysis occurs .

  • Following c-di-GMP activation, UDP-dependent repositioning of a gating loop either opens the catalytic pocket or coordinates the nucleotide at the active site .

  • A "finger helix" of BcsA moves toward the transmembrane (TM) channel entrance, correlating with the translocation of the cellulose polymer into the channel by one glucose unit .

  • The complex demonstrates precise coordination between catalytic activity and translocation, ensuring the growing polymer is efficiently moved across the membrane as it is synthesized.

This mechanism represents a remarkable example of coupled enzymatic and transport activities within a single protein complex.

What are common issues in recombinant bcsB expression and how can they be resolved?

Researchers frequently encounter several challenges when expressing recombinant bcsB:

IssuePossible CausesSolution Approaches
Poor expressionCodon bias, toxicityOptimize codon usage, use tightly regulated promoters, express with BcsA
InsolubilityMembrane association, improper foldingUse solubility tags (SUMO), lower induction temperature, add detergents
DegradationProtease sensitivityInclude protease inhibitors, use protease-deficient strains
Loss of activityImproper folding, lack of chaperonesCo-express with chaperones, expression at lower temperatures

For His-SUMO-tagged bcsB, expression in E. coli followed by rigorous testing to ensure purity greater than 90% (determined by SDS-PAGE) is recommended . For long-term stability, using Tris/PBS-based buffer with 6% trehalose at pH 8.0 and storage at -20°C/-80°C has proven effective .

What methods can be used to verify the structural integrity of purified bcsB?

Verifying structural integrity is crucial for meaningful functional studies. Researchers should employ multiple complementary approaches:

  • Circular Dichroism (CD) Spectroscopy: Assesses secondary structure content and thermal stability

  • Intrinsic Fluorescence: Evaluates tertiary structure and folding state

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS): Determines oligomeric state and homogeneity

  • Differential Scanning Fluorimetry (DSF): Measures thermal stability and can evaluate ligand binding

  • Binding Assays: Confirms functionality through c-di-GMP binding using techniques like isothermal titration calorimetry (ITC) or microscale thermophoresis (MST)

Structural characterization should be performed before functional studies to ensure that observed effects are due to specific molecular interactions rather than structural artifacts.

How can researchers differentiate between direct and indirect effects of bcsB mutations?

Distinguishing direct from indirect effects of bcsB mutations requires a systematic approach:

  • Complementation studies: Express wild-type bcsB in bcsB-knockout strains to confirm phenotype rescue

  • In vitro reconstitution: Reconstitute the BcsA-B complex with purified components to assess direct functional consequences

  • Binding studies: Use purified proteins to directly measure binding affinities and kinetics of interactions with c-di-GMP and other partners

  • Structural studies: Obtain crystal structures of mutant proteins to directly visualize structural changes

  • Single-subject experimental designs: Implement appropriate experimental designs (reversal, multiple baseline, or alternating treatment designs) to establish causal relationships between bcsB mutations and phenotypic changes

This multifaceted approach allows researchers to build a comprehensive understanding of bcsB function through complementary lines of evidence.

How might bcsB research inform anti-biofilm therapeutic strategies?

The involvement of bcsB in biofilm formation makes it a potential target for anti-biofilm therapeutics. Several promising research avenues include:

  • Small molecule inhibitors: Developing compounds that interfere with c-di-GMP binding to the BcsA-B complex could prevent biofilm formation without affecting bacterial viability, potentially reducing selection pressure for resistance .

  • Structural vaccinology: Using structural information about bcsB to design vaccines that target exposed epitopes, potentially disrupting biofilm formation in vivo.

  • CRISPR-Cas targeting: Designing CRISPR systems that specifically target bcsB genes to prevent biofilm formation in clinical settings.

  • Combination approaches: Developing strategies that combine conventional antibiotics with anti-biofilm agents targeting bcsB function to enhance efficacy against biofilm-associated infections.

The potential of these approaches is supported by research showing that P. fluorescens adaptations in chronic infections include overproduction of alginate and loss of flagellum and pili, leading to a sessile-biofilm lifestyle .

What are the similarities and differences in bcsB function across bacterial species?

Comparative analysis reveals both conservation and divergence in bcsB across bacterial species:

AspectConservationDivergenceImplications
StructureCore PilZ domainTerminal regionsFunction maintained despite sequence variation
c-di-GMP bindingArg-mediated recognitionBinding affinitiesDifferential regulation across species
Partner proteinsBcsA interactionAccessory protein interactionsSpecies-specific complex assembly
Regulatory mechanismsc-di-GMP activationResponse thresholdsAdaptation to different environmental niches

Studies on ABC transporters in Pseudomonas species provide insight into species-specific differences. For example, the P. fluorescens Has exporter secreted HasA proteins from P. fluorescens and P. aeruginosa but not S. marcescens HasA in E. coli, whereas the Has exporter from S. marcescens allowed secretion of all three HasA proteins . This suggests that similar species-specific differences might exist in bcsB function and regulation.

How can crystallographic methods be optimized for studying the BcsA-B complex?

Crystallographic studies of the BcsA-B complex have provided crucial insights into its structure and function. For researchers pursuing structural studies, optimized approaches include:

  • Bicelle crystallization method: This has proven successful for obtaining crystals of the c-di-GMP-bound BcsA-B complex at 2.65 Å resolution .

  • Crystal soaking: Soaking crystals with ligands such as UDP has enabled obtaining structures with both c-di-GMP and UDP bound at 3.2 Å resolution .

  • Beamtime access: Researchers can access specialized beamlines through several mechanisms:

    • General User Proposal (GUP) process for establishing ongoing work

    • RAPIDD program for shorter experiments

    • Collaborative Crystallography program at facilities like the Berkeley Center for Structural Biology (BCSB)

  • Complex stabilization: Using specific buffer compositions, detergents, and lipids to stabilize the membrane protein complex during crystallization.

These approaches have been instrumental in revealing the architecture of the activated BcsA-B complex and the mechanism of c-di-GMP signaling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.