Recombinant Pseudomonas fluorescens Disulfide bond formation protein B 1 (dsbB1)

Shipped with Ice Packs
In Stock

Description

Role in Disulfide Bond Formation

DsbB1 reoxidizes DsbA1, a periplasmic disulfide bond catalyst, to sustain its activity. This cycle enables:

  • Electron transfer: DsbB1 shuttles electrons from DsbA1 to membrane-bound quinones, regenerating DsbA1’s active state .

  • Pathway independence: In P. fluorescens, DsbA1 regulates antibiotic production (e.g., 2,4-DAPG) independently of the Gac/Rsm system, suggesting DsbB1’s role extends beyond canonical redox pathways .

Recombinant Production and Purification

While recombinant P. fluorescens dsbB1 has not been explicitly documented, protocols for P. aeruginosa dsbB1 (a close homolog) provide a template:

ParameterDetails
Expression systemE. coli (common host for recombinant protein production) .
Protein tagDetermined during production (e.g., His-tag for affinity chromatography) .
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C .
PurityOptimized via affinity and size-exclusion chromatography .

Key Findings in P. aeruginosa:

  • Redundancy: P. aeruginosa employs two DsbB proteins (DsbB1 and DsbB2), both capable of recycling DsbA1 .

  • Pathogenicity: Double dsbB1/dsbB2 mutants exhibit impaired virulence factor folding, highlighting their collective role .

Implications for P. fluorescens:

  • Antibiotic regulation: DsbB1 may indirectly influence 2,4-DAPG production by modulating DsbA1’s interaction with glucose dehydrogenase Gcd .

  • Structural determinants: Critical cysteine residues (e.g., C235, C275 in Gcd) are likely oxidized by DsbA1-DsbB1, affecting enzymatic activity .

Comparative Analysis of DsbB1 Across Species

FeatureP. fluorescens dsbB1P. aeruginosa dsbB1E. coli DsbB
Amino acid identity29% (vs. E. coli) 26% (vs. E. coli) Reference
RedundancyLikely present (DsbB2) PaDsbB1 and PaDsbB2 Single DsbB
Subcellular localizationInner membraneInner membraneInner membrane

Research Gaps and Future Directions

  • Structural studies: No crystal structures of P. fluorescens dsbB1 are available. Homology modeling using P. aeruginosa templates (e.g., Uniprot P21482) could bridge this gap.

  • Biotechnological potential: Engineered dsbB1 variants might enhance the production of disulfide-rich bioactive compounds in industrial Pseudomonas strains.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its incorporation.
Synonyms
dsbB1; Pfl01_4650; Disulfide bond formation protein B 1; Disulfide oxidoreductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain Pf0-1)
Target Names
dsbB1
Target Protein Sequence
MSEETIRLGRERRYLVLLGIICLALIGGALYMQIVLGEAPCPLCILQRYALLLIALFAFI GAAMRTRRSITVFEVLVVICAIAGAGVAGHHVYTQFYPAVSCGIDVLQPIVDDLPLAKIF PLGFQVDGFCSTPYPPILGLSLAQWALVAFVLVVILVPLLTSRNRKALR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. Functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of DsbB1 in Pseudomonas fluorescens?

DsbB1 in P. fluorescens functions as a membrane-bound oxidoreductase that is responsible for regenerating the oxidized form of DsbA proteins. DsbB1 transfers electrons from reduced DsbA to the electron transport chain via membrane-bound quinones. This continuous recycling allows DsbA to efficiently introduce disulfide bonds into newly synthesized periplasmic proteins, including secreted virulence factors. In the related species P. aeruginosa, two DsbB proteins (PaDsbB1 and PaDsbB2) have been identified that maintain the primary disulfide bond donor (PaDsbA1) in an oxidized state both in vitro and in vivo . Given the conservation of disulfide bond formation machinery among Pseudomonas species, P. fluorescens DsbB1 likely plays a similar crucial role in the oxidative protein folding pathway.

How does the structure of DsbB1 relate to its oxidoreductase function?

DsbB1 is a membrane protein containing four transmembrane segments with two essential cysteine pairs. The first pair is located in a periplasmic loop that interacts directly with DsbA, while the second pair is positioned near the membrane interface and interacts with membrane-bound quinones. This structural arrangement facilitates electron transfer from DsbA to the respiratory chain. Reconstitution studies with P. aeruginosa DsbB proteins have confirmed their ability to catalyze the oxidation of DsbA with kinetic parameters similar to those observed in E. coli, with an approximate Km value of 8-9 μM . The membrane localization of DsbB1 is critical for its function, as it connects the periplasmic disulfide formation pathway to the electron transport chain embedded in the cytoplasmic membrane.

Does P. fluorescens possess multiple DsbB proteins like P. aeruginosa?

While the search results don't specifically address P. fluorescens, it's notable that P. aeruginosa uniquely encodes two DsbB proteins (PaDsbB1 and PaDsbB2) that work cooperatively to maintain PaDsbA1 in an oxidized state . Analysis of the P. fluorescens genome would be necessary to determine whether it shares this redundancy or possesses a single DsbB protein like E. coli. Comparative genomic analyses focusing on oxidoreductase conservation would provide this information. If P. fluorescens does possess multiple DsbB proteins, researchers should investigate their functional redundancy and potentially specialized roles in different environmental conditions or with different substrate specificities.

How can researchers distinguish between the overlapping functions of DsbB1 and potential paralogs in P. fluorescens?

To distinguish between potential functional redundancy of DsbB paralogs in P. fluorescens, researchers should employ the following methodological approaches:

  • Generate single and double/multiple knockout mutants using targeted gene deletion techniques

  • Analyze the redox state of DsbA proteins in these mutants using AMS (4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid) trapping assays that detect free thiol groups

  • Conduct complementation studies expressing each DsbB paralog in mutant strains

  • Perform phenotypic assays focused on virulence factors known to contain disulfide bonds

This approach parallels studies in P. aeruginosa, where researchers determined that both PaDsbB1 and PaDsbB2 maintain PaDsbA1 in an oxidized state, and that deletion of both genes was required to significantly impair virulence factor production . Specifically, in P. aeruginosa, studies showed that deletion of both dsbB genes was necessary to affect the assembly of type IV pili and flagellum formation , suggesting functional redundancy. Similar approaches would clarify the roles of DsbB paralogs in P. fluorescens.

What are the kinetic parameters of the DsbB1-DsbA interaction in P. fluorescens, and how do they compare to other bacterial species?

The kinetic parameters of DsbB1-DsbA interactions can be determined using fluorescence-based assays that measure the decrease in intrinsic tryptophan fluorescence upon DsbA oxidation. Studies with P. aeruginosa DsbB proteins yielded Km values of approximately 8.1 μM for PaDsbB1 and 9.0 μM for PaDsbB2 in their interactions with PaDsbA1 . These values are comparable to those reported for E. coli DsbB-DsbA interactions.

To conduct similar studies with P. fluorescens proteins, researchers should:

  • Express and purify recombinant DsbB1 and DsbA proteins, maintaining DsbB1 in detergent micelles to preserve its membrane protein structure

  • Monitor the fluorescence decrease that accompanies DsbA oxidation at various DsbA concentrations

  • Fit the initial velocities to the Michaelis-Menten equation to determine Km and kcat values

  • Compare these values to those of other bacterial species to identify potential species-specific adaptations

This methodological approach would provide insights into the efficiency of the P. fluorescens disulfide bond formation pathway and how it may differ from other Pseudomonas species.

How does the expression of DsbB1 vary under different environmental conditions, and what regulatory mechanisms control its expression?

The expression of disulfide bond formation machinery may be regulated in response to environmental conditions that affect redox homeostasis or virulence factor production. In P. aeruginosa, PaDsbA2 appears to be expressed under specific conditions that have not been fully characterized . To investigate the regulation of DsbB1 expression in P. fluorescens, researchers should:

  • Construct transcriptional and translational reporter fusions to monitor DsbB1 expression

  • Analyze expression patterns under various conditions, including:

    • Oxidative stress (H₂O₂, diamide)

    • pH variations

    • Temperature shifts

    • Nutrient limitation

    • Host-simulating environments

  • Perform transcriptomic analyses to identify co-regulated genes

  • Conduct promoter analysis and DNA-protein interaction studies to identify transcription factors involved in regulation

Understanding the regulation of DsbB1 would provide insights into how P. fluorescens adapts its protein folding machinery to different environments and potentially identify conditions under which inhibition of this pathway might be most effective as an antimicrobial strategy.

What are the most effective methods for expressing and purifying recombinant P. fluorescens DsbB1?

Expressing and purifying membrane proteins like DsbB1 presents significant technical challenges. Based on approaches used for other DsbB proteins, researchers should consider the following methodological strategy:

  • Expression system selection:

    • E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • Inducible promoters (e.g., T7 or arabinose-inducible)

    • Fusion tags that facilitate purification (His₆-tag, often at the C-terminus)

  • Expression optimization:

    • Lower temperatures (16-20°C) during induction

    • Reduced inducer concentrations

    • Extended induction times (overnight)

  • Membrane extraction:

    • Carefully optimized detergent solubilization (n-dodecyl-β-D-maltoside or LDAO)

    • Differential centrifugation to isolate membrane fractions

  • Purification workflow:

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography to remove aggregates

    • Maintaining detergent above critical micelle concentration throughout

Researchers working with P. aeruginosa DsbB proteins have successfully used similar approaches, partially purifying the proteins and reconstituting them in vitro to study their enzymatic activities . Verification of proper folding and activity can be performed using fluorescence-based DsbA oxidation assays as described in the P. aeruginosa studies.

How can the redox state of DsbB1 be accurately measured in vivo?

Determining the in vivo redox state of DsbB1 is critical for understanding its function and potential adaptations to environmental changes. Researchers should employ the following methodology:

  • AMS alkylation technique:

    • Rapidly harvest bacteria and precipitate proteins with trichloroacetic acid (TCA)

    • Block free thiols with AMS, creating a 490 Da mass shift per thiol

    • Analyze by non-reducing SDS-PAGE followed by immunoblotting with anti-DsbB antibodies

  • Alternative approach using maleimide-PEG:

    • Use maleimide-PEG reagents for greater mass shifts (2-20 kDa)

    • Improved resolution for proteins with multiple cysteine residues

  • Controls and validation:

    • Include oxidized and reduced controls (treatment with oxidants or reductants)

    • Complement with mass spectrometry to precisely map modified residues

This approach parallels that used for analyzing the redox state of P. aeruginosa DsbA proteins, which showed that PaDsbA1 is predominantly oxidized in vivo . Similar techniques would be valuable for characterizing P. fluorescens DsbB1 and its interactions with other components of the disulfide bond formation machinery.

What assays can be used to identify the substrate proteins of the DsbB1-DsbA pathway in P. fluorescens?

Identifying the proteins that require disulfide bonds for proper folding is crucial for understanding the physiological importance of the DsbB1-DsbA pathway. Researchers should consider these complementary approaches:

  • Comparative proteomics:

    • Compare periplasmic and secreted proteomes of wild-type and dsbB1 mutant strains

    • Use stable isotope labeling (SILAC) or isobaric tags (TMT, iTRAQ) for quantitative comparison

    • Focus on proteins whose abundance decreases in the mutant

  • Thiol-trapping techniques:

    • Use diagonal electrophoresis to separate proteins based on disulfide bond content

    • Employ isotope-coded affinity tag (ICAT) labeling to quantify reduced vs. oxidized cysteines

  • DsbA substrate trapping:

    • Express DsbA variants with the second cysteine in the active site mutated

    • These variants form stable mixed disulfides with substrate proteins

    • Purify these complexes for identification by mass spectrometry

  • Functional analyses:

    • Assess specific enzyme activities known to require disulfide bonds

    • Screen for phenotypes associated with misfolded proteins (e.g., protease sensitivity)

Similar approaches with P. aeruginosa identified more than 20 potential substrates of PaDsbA1, including several virulence factors containing multiple conserved cysteine residues . This high-throughput proteomic approach would be similarly valuable for defining the substrate range of P. fluorescens DsbB1-DsbA.

What is the contribution of DsbB1 to P. fluorescens virulence in plant-pathogen interactions?

While P. fluorescens is often considered a beneficial rhizobacterium rather than a pathogen, some strains can cause disease in plants. The role of DsbB1 in these interactions can be investigated through:

  • Plant infection models:

    • Compare wild-type and dsbB1 mutant strains in appropriate plant models

    • Measure disease progression, bacterial proliferation, and plant defense responses

    • Evaluate colonization efficiency in both pathogenic and beneficial interactions

  • Virulence factor analysis:

    • Assess production of plant cell wall-degrading enzymes

    • Measure secretion and activity of proteases, lipases, and other hydrolytic enzymes

    • Quantify production of phytotoxins or plant growth-promoting compounds

  • Biofilm formation:

    • Evaluate the ability to form biofilms on plant surfaces

    • Analyze extracellular matrix production, which often involves disulfide-bonded proteins

Studies in P. aeruginosa have shown that disruption of the disulfide bond formation machinery dramatically decreases virulence , with impacts on specific virulence factors including type IV pili and flagellum assembly . Similar virulence attributes in P. fluorescens likely depend on proper disulfide bond formation, making DsbB1 potentially important for plant-microbe interactions.

How does DsbB1 affect the secretion and activity of extracellular enzymes in P. fluorescens?

Many secreted enzymes require disulfide bonds for stability and activity. To assess the impact of DsbB1 on these factors:

  • Enzyme activity assays:

    • Compare extracellular enzyme activities in wild-type and dsbB1 mutant culture supernatants

    • Focus on enzymes known to contain disulfide bonds (proteases, lipases, etc.)

    • Assess thermostability, which is often conferred by disulfide bonds

  • Secretion analysis:

    • Quantify protein levels in cellular and extracellular fractions

    • Distinguish between secretion defects and stability issues

    • Analyze the redox state of secreted proteins in different genetic backgrounds

  • Complementation studies:

    • Express dsbB1 in trans to confirm phenotype restoration

    • Assess cross-complementation with dsbB genes from other species

Studies with P. aeruginosa have shown that disruption of the Dsb system affects the secretion of multiple virulence factors, including elastase (LasB) and lipase, which contain disulfide bonds . For example, in a P. aeruginosa dsbA mutant, lipase activity in cell extracts and culture supernatants was reduced to about 25% . The presence of dithiothreitol (a reducing agent) in the growth medium completely inhibited extracellular lipase formation, confirming the importance of disulfide bonds for proper secretion . Similar dependencies likely exist for P. fluorescens extracellular enzymes.

What screening methods are most effective for identifying inhibitors of P. fluorescens DsbB1?

Developing inhibitors targeting DsbB1 requires robust screening methodologies. Based on approaches used for other bacterial Dsb proteins, researchers should consider:

  • Cell-based screening approaches:

    • Utilize E. coli dsbB knockout strains complemented with P. fluorescens dsbB1

    • Employ reporter systems that depend on disulfide bond formation, such as:

      • Alkaline phosphatase activity

      • β-galactosidase variants requiring disulfide bonds

      • Motility assays dependent on flagellar assembly

  • Biochemical screening approaches:

    • Develop fluorescence-based assays monitoring DsbA oxidation by DsbB1

    • Adapt colorimetric assays measuring quinone reduction

    • Implement high-throughput platforms for large compound libraries

A high-throughput screen of 216,767 compounds against P. aeruginosa DsbB1 and M. tuberculosis VKOR using E. coli cells has been reported , demonstrating the feasibility of such approaches. This screen utilized β-galactosidase reporters in complemented E. coli dsbB knockout strains to identify compounds that inhibit disulfide bond formation .

How might inhibitors of DsbB1 affect beneficial P. fluorescens strains in agricultural applications?

P. fluorescens strains are widely used as biocontrol agents and plant growth-promoting bacteria in agriculture. Therefore, it's important to consider potential unintended consequences of DsbB1 inhibition:

Since disulfide bond formation is essential for the stability of many secreted proteins that may be involved in beneficial interactions, researchers should carefully balance antimicrobial efficacy against potential ecological impacts when developing DsbB1 inhibitors.

What are the challenges in developing DsbB1 inhibitors as potential antimicrobials?

Developing DsbB1 inhibitors as antimicrobials presents several challenges that researchers must address:

  • Membrane protein targeting:

    • Limited accessibility due to membrane localization

    • Difficulty in achieving drug-like properties (solubility, permeability)

    • Potential for off-target effects on host membrane proteins

  • Selectivity issues:

    • Conservation of the disulfide bond formation machinery across bacteria

    • Need for compounds that discriminate between bacterial and human oxidoreductases

    • Potential impact on beneficial microbiota

  • Resistance potential:

    • Possibility of compensatory mutations in alternative pathways

    • Functional redundancy (as seen with PaDsbB1 and PaDsbB2 in P. aeruginosa)

    • Efflux pump-mediated resistance

  • Translational challenges:

    • Correlation between in vitro potency and in vivo efficacy

    • Appropriate animal models for testing efficacy

    • Pharmacokinetic/pharmacodynamic considerations

Despite these challenges, the essential nature of disulfide bond formation for bacterial virulence makes DsbB1 an attractive target. Studies have shown that disruption of the disulfide bond formation machinery dramatically decreases P. aeruginosa virulence , suggesting that inhibitors of this system could have therapeutic potential as anti-virulence agents rather than conventional antibiotics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.