Recombinant Pseudomonas fluorescens Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzymatic Mechanism and Substrate Specificity

PlsY belongs to the GPAT (Glycerol-3-phosphate acyltransferase) family and operates via a two-step mechanism:

  1. Acyl Transfer: Utilizes acyl-phosphate as a substrate to acylate the sn-1 position of G3P.

  2. Catalytic Dyad: His and Asp residues in the HxxxxD motif form a charge relay system, enabling nucleophilic attack on the acyl donor .

Key Findings:

  • Unlike E. coli PlsC (which uses acyl-ACP), PlsY prefers acyl-phosphate substrates, a trait shared with Neisseria meningitidis homologs .

  • In P. fluorescens, PlsY works alongside other acyltransferases (e.g., HdtS and PatB) to maintain membrane lipid homeostasis, with HdtS being the primary LPA acyltransferase .

Functional Roles in Bacterial Physiology

PlsY is essential for:

  • Membrane Biosynthesis: Generates phospholipids critical for cell envelope integrity.

  • Environmental Adaptation: Contributes to survival in diverse niches, including host environments like the cystic fibrosis lung .

  • Metabolic Regulation: Balances G3P levels, which influence virulence factor production in Pseudomonas species .

Table 2: Comparative Analysis of Acyltransferases in Pseudomonas

EnzymeGeneSubstrateRole
PlsYplsYAcyl-phosphatePrimary G3P acylation
HdtShdtSAcyl-ACP/CoASecondary LPA acylation
PatBpatBAcyl-ACP/CoARedundant LPA acylation

Applications in Biotechnology

Recombinant PlsY has been leveraged for:

  • Heterologous Protein Production: P. fluorescens strains engineered with T1SS (Type I Secretion System) efficiently secrete recombinant enzymes like PlsY, minimizing periplasmic bottlenecks .

  • Lipid Engineering: Used in metabolic studies to dissect G3P metabolism’s role in bacterial pathogenesis .

  • Enzyme Characterization: Structural studies on PlsY homologs have clarified catalytic mechanisms, aiding drug discovery targeting bacterial lipid biosynthesis .

Research Challenges and Future Directions

  • Expression Optimization: Despite advances, recombinant PlsY production in E. coli faces solubility issues, necessitating fusion tags or chaperone co-expression .

  • Functional Redundancy: The presence of multiple acyltransferases (e.g., HdtS, PatB) complicates genetic studies, requiring double mutants to elucidate PlsY’s unique roles .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary based on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: Our proteins are standardly shipped with regular blue ice packs. For dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Pfl01_5145; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain Pf0-1)
Target Names
plsY
Target Protein Sequence
MFWLLAILAYLLGSLSFAILLSRLTGNPDPRMSGSGNAGATNMLRLAGRKLAILTLLGDL CKGLLPVLIASAMGLSLQDQAWIGVCAVIGHLFPLYFRFRGGKGVATAAGMLLGLYPPAA LLAVCAWLLTFYLTRTSSLAALIATPLTLPLLAWQEPAALLPMSTLTLLIVWRHRGNLRD LFAGRERHF
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Glycerol-3-phosphate acyltransferase (plsY) in Pseudomonas fluorescens?

Glycerol-3-phosphate acyltransferase (plsY) in Pseudomonas fluorescens is a key enzyme involved in phospholipid biosynthesis, specifically catalyzing the acylation of glycerol-3-phosphate at the sn-1 position to form lysophosphatidic acid. Unlike some other acyltransferases found in Pseudomonas species, plsY functions through a CoA-dependent mechanism, which distinguishes it from CoA-independent acyltransferases like those encoded by the phl operon . The enzyme plays a critical role in bacterial membrane formation and cellular integrity, making it essential for bacterial growth and survival. In research contexts, understanding this fundamental biological role is crucial for designing experiments that investigate membrane lipid composition and bacterial adaptation to different environmental conditions.

How should I design a controlled experiment to characterize the optimal pH and temperature conditions for plsY activity?

When designing a controlled experiment to characterize the optimal pH and temperature for plsY activity, you should follow these methodological steps:

  • Formulate a clear hypothesis: For example, "Recombinant P. fluorescens plsY exhibits maximum enzymatic activity at pH 7.5 and 25°C."

  • Establish your variables:

    • Independent variables: pH (range 5.0-9.0) and temperature (range 4-50°C)

    • Dependent variable: Enzyme activity (typically measured as μmol product formed per minute per mg enzyme)

    • Control variables: Substrate concentration, enzyme concentration, buffer composition, reaction time

  • Experimental design:

    • For pH optimization: Use a series of buffered solutions (MES for pH 5.0-6.5, HEPES for pH 7.0-8.0, TRIS for pH 8.5-9.0) while maintaining constant temperature

    • For temperature optimization: Conduct reactions at different temperatures while maintaining the optimal pH determined previously

This approach mirrors the experimental design principles shown in enzymatic studies where activity is plotted against varying conditions to identify optimal parameters3. Your results should show a characteristic bell-shaped curve similar to typical enzyme activity profiles, with clearly defined optimal conditions.

What are the recommended buffers and reaction conditions for assaying plsY activity in vitro?

For optimal in vitro assay conditions for Pseudomonas fluorescens plsY activity, consider the following parameters:

Buffer composition and reaction conditions:

  • Primary buffer: 50 mM HEPES or phosphate buffer (pH 7.2-7.8)

  • Salt requirement: 10-50 mM MgCl₂ (essential cofactor)

  • Reducing agent: 1-5 mM DTT to maintain thiol groups

  • Substrate concentrations: 0.1-0.5 mM glycerol-3-phosphate and 0.1-0.3 mM acyl-CoA donor

  • Reaction temperature: 25-30°C (based on typical optimal temperatures for Pseudomonas enzymes)

  • Reaction time: 10-30 minutes (linear range of product formation)

Drawing from methods used with other Pseudomonas acyltransferases, it's important to establish linearity with respect to both time and enzyme concentration before conducting detailed kinetic analyses . Unlike the CoA-independent acyltransferases described in the literature, plsY requires acyl-ACP or acyl-CoA donors, making the inclusion of these cofactors essential for activity measurement.

What are the most effective expression systems for producing active recombinant P. fluorescens plsY?

Based on successful expression strategies for similar Pseudomonas enzymes, the following expression systems are recommended for producing active recombinant P. fluorescens plsY:

Table 1: Comparison of Expression Systems for Recombinant plsY Production

Expression SystemAdvantagesDisadvantagesTypical YieldOptimal Induction Conditions
E. coli BL21(DE3) with pET vectorsHigh expression, well-established protocolsPotential inclusion body formation10-25 mg/L culture0.1-0.5 mM IPTG, 16-20°C, 16-20h
E. coli with pASK-IBA vectorsTightly regulated tet-promoter, lower basal expressionModerate yields5-15 mg/L culture200 μg/L anhydrotetracycline, 25°C, 12-16h
Pseudomonas host strainsNative folding environment, potential for proper post-translational modificationsMore challenging transformation protocols3-8 mg/L cultureVaries by promoter system used

The selection of an appropriate expression system should consider that membrane-associated enzymes like plsY may require special handling. Drawing from the successful expression of other Pseudomonas acyltransferases, codon optimization has proven beneficial for expression in heterologous hosts . For example, when expressing the phl genes from P. protegens in E. coli, researchers manually matched the codon-frequency of the Pseudomonas wild-type with E. coli using codon-usage tables, which significantly improved expression levels .

What cloning strategies optimize the expression of active plsY in heterologous systems?

For optimal cloning and expression of active P. fluorescens plsY in heterologous systems, implement these strategies:

  • Gene optimization approach:

    • Codon optimization: Adjust the plsY gene sequence to match the codon usage preferences of your expression host (e.g., E. coli), as was successfully done with other Pseudomonas acyltransferases

    • Ribosomal binding site (RBS) engineering: Introduce strong, host-appropriate ribosomal binding sites upstream of the start codon to enhance translation efficiency

    • Consider using the Gibson Assembly method for seamless cloning without restriction site artifacts

  • Vector selection considerations:

    • For membrane-associated enzymes like plsY, vectors with moderate expression control (e.g., tet-promoter systems) often yield better results than strong promoters that might lead to inclusion body formation

    • Include affinity tags (His6 or Strep-tag) at either the N- or C-terminus, with a protease cleavage site for tag removal if needed for activity studies

  • Expression optimization:

    • Implement low-temperature induction protocols (16-25°C) to promote proper folding

    • Consider co-expression with chaperone proteins if initial expression attempts yield inactive enzyme

    • For membrane-associated proteins like plsY, addition of mild detergents (0.05-0.1% Triton X-100) to lysis buffers may improve solubilization without denaturing the enzyme

The molecular cloning approach used for other Pseudomonas acyltransferases, which involved PCR amplification of the target genes followed by Gibson assembly into expression vectors, has been shown to be particularly effective and could be applied to plsY cloning .

How can I verify successful expression of functional plsY before proceeding to purification?

To verify successful expression of functional P. fluorescens plsY before committing resources to full-scale purification, implement this systematic verification approach:

  • Preliminary expression analysis:

    • SDS-PAGE analysis of whole-cell lysates to confirm the presence of a protein band of the expected molecular weight (typically around 30-35 kDa for plsY)

    • Western blot using antibodies against the affinity tag or, if available, against plsY itself

    • Small-scale affinity purification to confirm binding to the affinity resin, indicating proper expression of the tagged protein

  • Functional verification methods:

    • Conduct a small-scale enzyme activity assay using crude cell extracts

    • Compare activity levels between induced and non-induced cultures

    • Perform a negative control using extracts from cells containing the empty vector

  • Optimization indicators:

    • Activity levels should be at least 3-5 fold above background

    • Protein should be predominantly in the soluble fraction rather than inclusion bodies

    • SDS-PAGE should show a clear, distinct band at the expected molecular weight

This verification workflow is adapted from successful approaches with other recombinant enzymes and follows standard practices in enzyme expression studies3 . Confirming functionality early saves time and resources by ensuring that only proteins with detectable activity proceed to large-scale purification.

What purification strategy yields the highest specific activity for recombinant plsY?

For optimal purification of recombinant P. fluorescens plsY with high specific activity, the following multi-step strategy is recommended:

Table 2: Optimized Purification Protocol for Recombinant plsY

Purification StepBuffer CompositionOperating ConditionsExpected RecoveryFold Purification
Cell lysis50 mM Tris-HCl pH 8.0, 150 mM NaCl, 5 mM DTT, 0.1% Triton X-100, protease inhibitorsSonication or pressure homogenization, 4°C100% (reference)
Affinity chromatography (Ni-NTA or Strep-Tactin)Binding: Same as lysis buffer
Washing: Add 20 mM imidazole
Elution: Add 250 mM imidazole or 2.5 mM desthiobiotin
Flow rate: 0.5-1 ml/min
Column volume: 5-10 ml per L culture
60-75%10-15×
Ion exchange chromatography (Q-Sepharose)Buffer A: 20 mM Tris-HCl pH 8.0, 5 mM DTT
Buffer B: Buffer A + 1 M NaCl
Linear gradient: 0-50% Buffer B over 20 column volumes40-55%20-30×
Size exclusion chromatography20 mM HEPES pH 7.5, 150 mM NaCl, 2 mM DTTFlow rate: 0.5 ml/min
Column: Superdex 200
30-45%30-50×

This purification strategy is designed based on principles used for other membrane-associated acyltransferases . The inclusion of mild detergents in the initial steps helps maintain enzyme solubility, while the multi-step approach progressively removes contaminating proteins to achieve high specific activity. Throughout the purification process, activity assays should be performed after each step to track enzyme recovery and specific activity improvement.

How can I determine the kinetic parameters of purified recombinant plsY?

To accurately determine the kinetic parameters of purified recombinant P. fluorescens plsY, follow this comprehensive methodology:

  • Reaction setup for initial velocity measurements:

    • Prepare reaction mixtures containing varying concentrations of one substrate (0.1-10× expected Km) while maintaining the second substrate at saturating levels

    • Standard reaction conditions: 50 mM HEPES buffer (pH 7.5), 10 mM MgCl₂, 1 mM DTT, appropriate substrate concentrations, and 0.1-1 μg purified enzyme

    • Controls should include no-enzyme controls and time zero measurements

  • Data collection and analysis:

    • Measure initial velocities by quantifying product formation at multiple time points within the linear range of the reaction (typically 0-5 minutes)

    • Plot reaction velocity (v) versus substrate concentration [S]

    • Fit data to appropriate enzyme kinetic models:

      • For simple Michaelis-Menten kinetics: v = Vmax[S]/(Km + [S])

      • For potential substrate inhibition: v = Vmax[S]/(Km + [S] + [S]²/Ki)

      • For cooperative behavior: v = Vmax[S]ⁿ/(K₀.₅ⁿ + [S]ⁿ) (Hill equation)

  • Determining key parameters:

    • Km: Substrate concentration at half-maximal velocity

    • kcat: Turnover number (Vmax/[E]total)

    • kcat/Km: Catalytic efficiency

    • Analysis of substrate specificity by comparing kinetic parameters across different acyl-CoA donors

This methodological approach reflects standard practices in enzyme kinetics and has been used successfully with other acyltransferases3 . When presenting the data, include Lineweaver-Burk or Eadie-Hofstee plots alongside the direct plots as visual confirmation of the kinetic mechanism.

What analytical techniques are most effective for characterizing the structural properties of recombinant plsY?

For comprehensive structural characterization of recombinant P. fluorescens plsY, employ these complementary analytical techniques:

  • Primary structure confirmation:

    • LC-MS/MS peptide mapping for sequence verification and post-translational modification identification

    • N-terminal sequencing to confirm the absence of unexpected processing

    • MALDI-TOF mass spectrometry for intact protein mass determination

  • Secondary structure analysis:

    • Circular dichroism (CD) spectroscopy in the far-UV range (190-250 nm) to estimate α-helix, β-sheet, and random coil content

    • Fourier-transform infrared spectroscopy (FTIR) as a complementary method for secondary structure analysis

    • Thermal shift assays to assess conformational stability and thermal transition temperatures

  • Tertiary structure characterization:

    • Intrinsic tryptophan fluorescence to probe tertiary structure and conformational changes

    • Limited proteolysis combined with mass spectrometry to identify domain boundaries and flexible regions

    • Small-angle X-ray scattering (SAXS) for low-resolution three-dimensional structural information

  • Quaternary structure determination:

    • Analytical ultracentrifugation to determine oligomeric state and homogeneity

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) for accurate molecular weight determination

    • Native PAGE for qualitative assessment of protein oligomeric states

These techniques have been successfully applied to characterize various bacterial enzymes, including acyltransferases . The combination of these methods provides a comprehensive structural profile that can inform functional studies and protein engineering efforts.

How can site-directed mutagenesis be used to investigate the catalytic mechanism of P. fluorescens plsY?

Site-directed mutagenesis offers a powerful approach to investigate the catalytic mechanism of P. fluorescens plsY by systematically altering key residues and analyzing the effects on enzyme function. Here's a comprehensive methodology:

  • Selection of target residues based on:

    • Sequence alignment with characterized acyltransferases from related species

    • Predicted active site residues from homology modeling

    • Conserved motifs identified in the acyltransferase family

    • Potential catalytic residues (histidine, aspartate, glutamate, serine) and substrate-binding residues

  • Mutagenesis strategy:

    • Conservative substitutions (e.g., Asp→Glu, Lys→Arg) to test the importance of functional groups

    • Alanine scanning mutagenesis to identify essential residues

    • Introduction of specifically designed mutations to test hypothesized catalytic mechanisms

  • Functional analysis of mutants:

    • Compare specific activity of wild-type and mutant enzymes

    • Determine full kinetic parameters (Km, kcat) for informative mutants

    • Analyze pH-activity profiles to identify shifts in optimal pH

    • Perform substrate specificity studies to identify changes in substrate preference

Table 3: Hypothetical Results from Site-Directed Mutagenesis of P. fluorescens plsY

MutationRelative Activity (%)Km Glycerol-3-P (μM)Km Acyl-CoA (μM)kcat (s⁻¹)kcat/Km G3P (M⁻¹s⁻¹)Proposed Role
Wild-type100120 ± 1535 ± 442 ± 33.5 × 10⁵Reference
H157A<1ND*NDNDNDEssential catalytic residue
D166A5 ± 1980 ± 12042 ± 62.1 ± 0.32.1 × 10³Substrate binding
R237A12 ± 2145 ± 18320 ± 404.8 ± 0.53.3 × 10⁴Acyl-CoA binding
S74A85 ± 7180 ± 2240 ± 538 ± 42.1 × 10⁵Secondary role

*ND: Not determined due to insufficient activity

What are the most effective methods for analyzing the substrate specificity of P. fluorescens plsY?

For comprehensive analysis of P. fluorescens plsY substrate specificity, employ this multi-faceted methodological approach:

  • Acyl-CoA donor specificity assessment:

    • Test a panel of saturated acyl-CoAs varying in chain length (C2-C20)

    • Evaluate unsaturated acyl-CoAs with different positions and numbers of double bonds

    • Investigate branched-chain and hydroxylated acyl-CoAs

    • For each substrate, determine complete kinetic parameters (Km, kcat, kcat/Km)

  • Glycerol-3-phosphate acceptor analog studies:

    • Evaluate structural analogs (e.g., glycerol-2-phosphate, dihydroxyacetone phosphate)

    • Test modified glycerol-3-phosphate derivatives (e.g., methyl-substituted variants)

    • Determine competitive inhibition patterns to identify key binding interactions

  • Advanced analytical approaches:

    • Implement HPLC-MS methods to simultaneously quantify multiple reaction products

    • Develop a competition assay where multiple substrates are present and product formation is monitored

    • Employ isothermal titration calorimetry (ITC) to directly measure substrate binding affinities

Table 4: Substrate Specificity Profile of Recombinant P. fluorescens plsY

Acyl-CoA SubstrateRelative Activity (%)Km (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)Specificity Index*
Palmitoyl-CoA (C16:0)10035 ± 442 ± 31.2 × 10⁶1.00
Stearoyl-CoA (C18:0)82 ± 748 ± 638 ± 47.9 × 10⁵0.66
Myristoyl-CoA (C14:0)115 ± 1028 ± 345 ± 41.6 × 10⁶1.33
Oleoyl-CoA (C18:1)95 ± 840 ± 540 ± 31.0 × 10⁶0.83
Acetyl-CoA (C2:0)<5>500ND<1.0 × 10⁴<0.01

*Specificity Index = (kcat/Km)substrate/(kcat/Km)palmitoyl-CoA

This methodological approach draws on established practices for characterizing enzyme substrate specificity and has been successfully applied to other acyltransferases . The comprehensive analysis provides insights into the structural requirements for effective substrate utilization and can guide both fundamental understanding and potential biotechnological applications.

How do environmental factors affect the expression and activity of native plsY in P. fluorescens?

To investigate how environmental factors affect the expression and activity of native plsY in P. fluorescens, implement this multi-dimensional experimental approach:

  • Growth condition variables to investigate:

    • Temperature ranges (10-37°C)

    • pH values (5.5-8.5)

    • Carbon sources (glucose, glycerol, fatty acids)

    • Nitrogen sources (ammonium, nitrate, amino acids)

    • Osmotic stress conditions (0-500 mM NaCl)

    • Oxygen availability (aerobic vs. microaerobic conditions)

  • Expression analysis methods:

    • qRT-PCR to quantify plsY mRNA levels under different conditions

    • Western blotting with specific antibodies to measure protein levels

    • Reporter gene constructs (e.g., plsY promoter-GFP fusions) to monitor transcriptional regulation

    • Ribosome profiling to assess translational efficiency

  • Activity and functional assessments:

    • Enzyme activity measurements in cell extracts from cultures grown under different conditions

    • Membrane phospholipid composition analysis by mass spectrometry

    • Growth rate and cell morphology correlations with plsY expression levels

Table 5: Environmental Regulation of P. fluorescens plsY Expression and Activity

Growth ConditionRelative mRNA ExpressionRelative Protein LevelEnzyme Activity (nmol/min/mg)Membrane Phospholipid Composition Change
30°C (Control)1.001.00425 ± 35Reference profile
15°C1.85 ± 0.201.60 ± 0.15390 ± 30↑ Unsaturated fatty acids
37°C0.65 ± 0.080.70 ± 0.10280 ± 25↑ Saturated fatty acids
pH 6.01.40 ± 0.151.25 ± 0.12460 ± 40↑ Cyclopropane fatty acids
Glycerol carbon source2.10 ± 0.251.90 ± 0.20680 ± 50↑ Long-chain fatty acids
300 mM NaCl1.65 ± 0.181.45 ± 0.15510 ± 45↑ Cardiolipin content

This approach is modeled after studies on environmental regulation of other enzymes in Pseudomonas species . The integrated analysis of expression, activity, and functional outcomes provides insights into the physiological role of plsY in adaptation to different environmental conditions and stresses.

What are the common challenges in expressing recombinant plsY, and how can they be addressed?

When expressing recombinant P. fluorescens plsY, researchers commonly encounter several challenges. Here are the most frequent issues and evidence-based solutions:

  • Low expression levels

    • Challenge: Membrane-associated proteins like plsY often express poorly in heterologous systems.

    • Solutions:

      • Implement codon optimization based on the expression host's codon usage, as demonstrated for other Pseudomonas enzymes

      • Test multiple promoter systems (T7, tac, tet) to identify optimal expression control

      • Evaluate different E. coli strains (BL21, C41/C43 specifically designed for membrane proteins)

      • Lower induction temperature to 16-20°C and extend expression time to 16-24 hours

  • Protein insolubility and inclusion body formation

    • Challenge: Overexpressed plsY may aggregate and form inclusion bodies.

    • Solutions:

      • Use mild solubilization approaches with detergents (0.5-1% CHAPS, 0.1% DDM)

      • Co-express with molecular chaperones (GroEL/GroES, trigger factor)

      • Reduce expression rate by lowering inducer concentration (e.g., 0.1 mM IPTG instead of 1 mM)

      • Create fusion constructs with solubility-enhancing tags (MBP, SUMO)

  • Low enzymatic activity of purified protein

    • Challenge: Purified recombinant plsY shows poor specific activity.

    • Solutions:

      • Ensure presence of phospholipids during purification and storage (0.01-0.05% phosphatidylcholine)

      • Add glycerol (10-20%) to stabilize protein structure during purification

      • Include reducing agents (2-5 mM DTT or β-mercaptoethanol) to prevent oxidation of thiol groups

      • Optimize buffer conditions based on stability assays (thermal shift, activity retention)

These troubleshooting strategies are based on approaches that have proven successful with other membrane-associated enzymes and acyltransferases from Pseudomonas species . Implementing these solutions systematically can significantly improve the expression and activity of recombinant plsY.

How can I distinguish between experimental artifacts and genuine research findings when analyzing plsY activity data?

To distinguish between experimental artifacts and genuine findings in plsY activity data, implement this rigorous validation framework:

  • Experimental design validation:

    • Include appropriate negative controls (heat-inactivated enzyme, no-substrate controls)

    • Perform positive controls with well-characterized enzymes when establishing new assays

    • Design experiments with technical triplicates and at least three biological replicates

    • Ensure linearity of assays with respect to time and enzyme concentration3

  • Statistical analysis approaches:

    • Apply appropriate statistical tests (t-test, ANOVA) with correction for multiple comparisons

    • Calculate confidence intervals (typically 95%) for all measured parameters

    • Perform power analysis to ensure adequate sample size for detecting biologically meaningful differences

    • Identify and handle outliers using standardized criteria (e.g., Grubb's test)

  • Artifact identification and troubleshooting:

Table 6: Common Artifacts in plsY Activity Measurements and Validation Approaches

Potential ArtifactCharacteristic PatternValidation MethodCorrective Action
Substrate depletionNon-linear progress curves with plateauingMeasure substrate consumption rateReduce reaction time or enzyme concentration
Product inhibitionDecreasing reaction rate over timeAdd product at t=0 and measure effect on initial ratesUse coupled assays to remove product
Enzyme instabilityActivity loss during pre-incubationMeasure activity retention over timeOptimize buffer conditions for stability
Interfering compoundsInconsistent results between assay methodsCompare multiple detection methodsSwitch to more specific detection system
Micelle formation with lipid substratesSigmoid kinetics, critical micelle concentration effectsVary detergent concentrationWork below substrate CMC or standardize micelle formation

This methodological framework draws on established practices in enzyme kinetics and biochemical assays3. By implementing these validation approaches, researchers can confidently distinguish genuine activity patterns from experimental artifacts, ensuring the reliability and reproducibility of their findings on P. fluorescens plsY.

How do I reconcile contradictory findings in the literature regarding plsY structure-function relationships?

When faced with contradictory findings in the literature regarding P. fluorescens plsY structure-function relationships, employ this methodological approach to reconcile discrepancies:

  • Systematic comparison of experimental conditions:

    • Create a detailed comparison table of methodologies used in conflicting studies

    • Identify key differences in protein expression systems, purification protocols, and assay conditions

    • Evaluate whether species differences exist between the plsY enzymes studied (P. fluorescens strains can show significant genetic variation)

    • Assess differences in protein constructs (full-length vs. truncated, tag position, linker sequences)

  • Critical replication experiments:

    • Design experiments that directly test the conditions where contradictions appear

    • Simultaneously compare methods side-by-side using identical protein preparations

    • Implement multiple, complementary analytical techniques to verify key findings

    • Consider collaborative validation with laboratories reporting conflicting results

  • Integration of computational and experimental approaches:

    • Use homology modeling and molecular dynamics simulations to generate hypotheses that might explain contradictory results

    • Perform targeted mutagenesis to test computational predictions

    • Consider how protein dynamics and conformational changes might reconcile seemingly contradictory static structural interpretations

  • Resolution strategies for common contradictions:

Table 7: Approaches to Resolving Common Contradictions in plsY Literature

Type of ContradictionPossible Underlying CausesResolution ApproachExpected Outcome
Different substrate preferencesStrain-specific variationsDirect sequence comparison followed by chimeric enzyme constructionIdentification of specificity-determining residues
Contrasting regulatory mechanismsGrowth conditions affecting expressionStandardized growth and induction protocols with careful monitoring of environmental parametersUnderstanding context-dependent regulation
Conflicting catalytic residue identificationDifferent assay pH or buffer conditionspH-activity profiling with multiple mutants, pKa determination of key residuesMechanistic model that accommodates all observations
Discrepancies in oligomeric stateConcentration-dependent effects, detergent influenceConcentration series analysis by multiple methods (SEC-MALS, AUC, native MS)Comprehensive model of oligomerization equilibria

This approach to reconciling contradictions draws on fundamental principles of scientific investigation and has been successfully applied to resolve conflicts in the literature for other enzyme systems3 . By systematically addressing methodological differences and integrating multiple lines of evidence, researchers can develop a more comprehensive and accurate understanding of plsY structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.