Recombinant Pseudomonas fluorescens Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Pseudomonas fluorescens Large-Conductance Mechanosensitive Channel (MscL)

Recombinant Pseudomonas fluorescens Large-conductance mechanosensitive channel (MscL) refers to the MscL protein produced using recombinant DNA technology in Pseudomonas fluorescens. MscL is a mechanosensitive ion channel found in bacteria, including P. fluorescens, that opens in response to mechanical stimuli such as membrane stretch . These channels are crucial for bacterial survival, protecting cells from osmotic shock by releasing solutes when the membrane tension increases .

Genetic Manipulation of P. fluorescens for Protein Production

To improve the efficiency of recombinant protein production, genetic modifications can be made to P. fluorescens. For instance, deleting fleQ, the master regulator of flagella gene expression, results in a strain (P. fluorescens ΔfleQ) that does not produce flagella-related proteins, simplifying purification processes .

Role of MscL in Mechanosensitivity

MscL channels in P. fluorescens respond to mechanical forces, particularly membrane tension. These channels open when the cell membrane is stretched, allowing ions and small molecules to flow through, which helps to reduce the osmotic pressure inside the cell and prevents cell lysis . The recombinant form of MscL is often used in research to study the structure, function, and gating mechanisms of mechanosensitive channels .

Research Applications of Recombinant P. fluorescens MscL

Recombinant P. fluorescens MscL is utilized in various research applications, including:

  • Structural Biology: Determining the high-resolution structure of MscL using X-ray crystallography or cryo-electron microscopy to understand its gating mechanism .

  • Electrophysiology: Studying the channel's electrophysiological properties using patch-clamp techniques to measure ion flow and response to mechanical stimuli .

  • Drug Discovery: Screening for compounds that can modulate MscL activity, which could lead to new drugs targeting bacterial infections or other conditions involving mechanosensitive channels .

Motility and Biofilm Formation

The motility of P. fluorescens is complex and influenced by several genes. Genes such as Pfl01_1508 and Pfl01_1517 affect motility and biofilm formation differently . Deletion of genes like Pfl01_1516, Pfl01_1572, and Pfl01_1573 leads to motility defects, indicating an additional level of complexity in flagellum function control .

Genes Influencing Motility and Biofilm Formation in P. fluorescens

GenePredicted Product(s)Homologous Gene (% identity)MotilityBiofilm
Pfl01_1508Glycosyl transferase, family 2 (fgtA1)P. syringae pv. syringae B728a Psyr_3469 (57)--
Pfl01_1516Cephalosporin hydroxylase (flhH)P. putida strain W619 PputW619_3713 (70)--
Pfl01_1517Glycosyl transferase, family 2 (fgtA2)P. putida strain W619 PputW619_3712 (56)++
Pfl01_1572Chemotaxis protein (cheW)Pseudomonas putida KT2440 cheW (91)--
Pfl01_1573Conserved hypothetical protein in Pseudomonas (flhH)P. fluorescens Pf-5 Pfl_1677 (80)++

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Pfl01_4887; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain Pf0-1)
Target Names
mscL
Target Protein Sequence
MGVLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPIGLLIGGVDFSDLAIT LKAAEGSAPAVVLAYGKFIQSVLDFVIVAFAIFMGVKAINRLKREEAVAPTLPPVPTKEE ELLGEIRDLLKAQNNRP
Uniprot No.

Target Background

Function
A mechanosensitive ion channel that opens in response to membrane stretch. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of MscL in Pseudomonas fluorescens?

MscL (mechanosensitive channel of large conductance) functions as a pressure-relief valve protecting bacterial cells from lysing during acute osmotic downshock. When the bacterial membrane is stretched due to osmotic pressure changes, MscL responds to the increased membrane tension by opening a nonselective pore approximately 30 Å wide, exhibiting a large unitary conductance of approximately 3 nS. This mechanism allows rapid release of solutes, preventing cell lysis under hypoosmotic conditions .

How does P. fluorescens MscL compare to other bacterial MscL proteins in terms of basic structure?

P. fluorescens MscL shares structural similarity with other bacterial MscL proteins, such as those from M. tuberculosis and E. coli. The basic structure consists of a homopentamer with each subunit formed by two transmembrane segments (TM1 and TM2) and a cytoplasmic helix forming a five-helix bundle. While the sequence identity between E. coli and M. tuberculosis MscL is about 36%, P. fluorescens MscL maintains the core structural elements essential for mechanosensation. The variations in sequence and structure between species contribute to subtle differences in gating properties and sensitivity to membrane tension .

What are the physiological conditions under which MscL is activated in P. fluorescens?

MscL in P. fluorescens, like in other bacteria, is primarily activated under conditions of acute hypoosmotic shock when water rapidly enters the cell, causing membrane stretching. The channel gates at a high-pressure threshold near the lytic limit of the cell membrane. It remains closed under normal physiological conditions with zero transbilayer pressure and only opens when membrane tension increases significantly. This selective activation ensures that the channel serves as an emergency release valve only during critical osmotic stress conditions that could otherwise result in cell lysis .

What conformational changes occur during the gating process of MscL?

The gating of MscL involves coordinated and extensive conformational rearrangements across multiple structural domains. Based on studies of MscL from M. acetivorans and other species, these changes include:

  • Significant tilting of the two transmembrane helices (TM1 and TM2), consistent with a helix-pivoting model

  • Transformation of the periplasmic loop region from a folded structure (containing an ω-shaped loop and a short β-hairpin) to an extended and partly disordered conformation

  • Rotating and sliding of the N-terminal helix (N-helix) coupled to the tilting movements of TM1 and TM2

These coordinated movements result in an iris-like opening of the central pore to approximately 30 Å, which becomes permeable to water, ions, metabolites, and even small proteins during full channel activation .

How do the transmembrane domains of P. fluorescens MscL contribute to channel function?

The two transmembrane domains (TM1 and TM2) of P. fluorescens MscL play distinct but complementary roles in channel function:

TM1 forms the inner lining of the pore and undergoes more substantial conformational changes during gating. It contains several highly conserved residues that are critical for channel function and contributes significantly to the channel's tension sensing.

TM2 forms the outer face of the channel in contact with the lipid bilayer and serves as a stabilizing element. It undergoes less dramatic movements than TM1 during gating but is essential for anchoring the channel in the membrane and transmitting membrane tension forces to the pore-forming regions.

The specific interactions between TM1 and TM2, as well as their interactions with membrane lipids, are crucial for proper mechanosensing and channel gating .

What is the role of the N-terminal domain in MscL function?

The N-terminal helix (N-helix) of MscL serves as a membrane-anchored stopper that limits the tilting movements of the transmembrane helices TM1 and TM2 during the gating process. Studies comparing closed and expanded intermediate states reveal significant rotation and sliding of the N-helix coupled to the tilting of TM1 and TM2. This dynamic relationship suggests that the N-helix plays a critical role in regulating the extent of channel opening and possibly contributes to the tension sensitivity of the channel. Mutations or modifications in this region often result in altered gating properties, underscoring its importance in MscL function .

What techniques are most effective for studying the structure-function relationship of recombinant P. fluorescens MscL?

Several complementary techniques have proven effective for studying the structure-function relationship of MscL:

  • Site-Directed Spin-Labeling Analysis with EPR Spectroscopy: This approach combines cysteine chemistry and site-directed spin labeling to study the structure and dynamics of MscL in native-like lipid environments. It provides valuable information about residue environmental properties, accessibility, and conformational changes during gating.

  • X-ray Crystallography: Has been successful in determining the structure of MscL from various species in closed states, providing a baseline for understanding structural transitions.

  • Electron Paramagnetic Resonance (EPR): Particularly useful for determining solvent accessibility of specific residues and monitoring conformational changes under physiological conditions.

  • Electrophysiology (Patch-Clamp): Essential for functional characterization of MscL gating properties and conductance measurements.

  • Molecular Dynamics Simulations: Complementary to experimental approaches for modeling conformational changes during channel gating.

These methods together provide a comprehensive understanding of how structural elements contribute to the mechanosensing and gating mechanisms of MscL .

How can researchers optimize expression systems for recombinant P. fluorescens MscL production?

Optimizing expression systems for recombinant P. fluorescens MscL requires careful consideration of several parameters:

Medium Composition Optimization:
Based on studies with P. fluorescens, an optimized medium composition for biomass production consists of:

  • Sucrose: 8.0 g/L

  • Yeast extract: 3.0 g/L

  • Di-potassium phosphate: 2.0 g/L

  • Magnesium sulfate heptahydrate: 1.5 g/L

This formulation was determined through a combination of one-factor-at-time (OFAT) and response surface methodology (RSM) approaches using Box-Behnken experimental design, with analysis of variance (ANOVA) showing significance for each factor with a high coefficient of determination (R² = 95.58%) .

Expression Strategy Considerations:

  • Select an appropriate host strain (often E. coli BL21(DE3) or similar strains)

  • Optimize codon usage for the host organism

  • Use controlled induction conditions (temperature, inducer concentration)

  • Consider fusion tags that enhance protein solubility and facilitate purification

  • Scale up cultivation in bioreactors with optimized parameters (pH, temperature, dissolved oxygen)

The expression should be verified through SDS-PAGE and Western blotting, with functional validation through reconstitution in liposomes followed by electrophysiological characterization .

What are the challenges in distinguishing between closed and open states in MscL structural studies?

Distinguishing between closed and open states in MscL structural studies presents several challenges:

  • Dynamic Nature of the Transition: The gating process involves multiple intermediate states between fully closed and fully open conformations, making it difficult to capture discrete states.

  • Membrane Environment Requirements: MscL function is highly dependent on the lipid environment, which is difficult to replicate in many structural studies. Detergent micelles used in crystallography may not accurately represent the native membrane environment.

  • Stabilization Issues: The open state is energetically unfavorable in the absence of membrane tension, making it challenging to stabilize for structural analysis.

  • Methodological Limitations:

    • Crystallography struggles with capturing dynamic states

    • EPR provides good dynamic information but lower resolution

    • Cryo-EM has resolution limitations for smaller membrane proteins

  • Structural Heterogeneity: Even within a specific functional state, there can be structural heterogeneity, complicating data interpretation.

Researchers have addressed these challenges through innovative approaches such as using fusion proteins and controlling detergent composition to trap specific conformational states, as demonstrated in studies of M. acetivorans MscL in both closed and expanded intermediate states .

How do lipid-protein interactions influence the mechanosensing properties of P. fluorescens MscL?

Lipid-protein interactions play a critical role in the mechanosensing properties of MscL channels. Several key mechanisms have been identified:

  • Hydrophobic Matching: The hydrophobic thickness of the membrane affects the energetics of MscL gating. Thinner membranes reduce the energy barrier for channel opening by creating hydrophobic mismatch with the transmembrane domains.

  • Lateral Pressure Profile: The distribution of lateral pressure across the membrane bilayer directly affects the energetics of conformational changes in MscL. Lipids with different shapes (cylindrical, conical) alter this profile and thereby affect channel gating.

  • Specific Lipid Interactions: Certain lipids interact specifically with residues in MscL, particularly in TM2 which interfaces with the membrane. These interactions can stabilize particular conformations of the channel.

  • Membrane Curvature Effects: MscL is sensitive to membrane curvature, which can be modulated by lipid composition. This sensitivity contributes to its mechanosensing capabilities.

As emphasized in the literature, "given the critical role that lipid–protein interactions play in MscL function, an important question that remains to be answered is the degree to which the X-ray structure of MscL determined in detergent micelles resembles that in its native environment." This highlights the importance of studying MscL in conditions that preserve native lipid-protein interactions .

What are the latest findings on the molecular mechanism of mechanical force transduction in MscL?

Recent studies on MscL have provided significant insights into the molecular mechanism of mechanical force transduction:

These findings collectively demonstrate that force transduction in MscL involves a sophisticated and coordinated rearrangement of multiple structural elements, converting membrane tension into mechanical work that opens the channel pore .

What potential biotechnological applications exist for engineered P. fluorescens MscL variants?

Engineered MscL variants offer several promising biotechnological applications:

  • Controlled Release Systems: MscL can be converted into light-activated nanovalves useful for triggered release of compounds in liposomes. This has potential applications in drug delivery systems where controlled release is desired .

  • Antimicrobial Agent Delivery: Studies suggest that the open pore of MscL permits entry of antibiotics like streptomycin and could potentially serve as a target for antimicrobial agents. Engineered MscL variants could enhance antibiotic uptake in resistant bacteria .

  • Biosensors: MscL's mechanosensitive properties can be exploited to develop tension-sensing elements in biosensors for detecting mechanical forces or osmotic changes.

  • Synthetic Biology Tools: Engineered MscL channels with modified gating properties or sensitivities could serve as controllable pores in synthetic cellular systems.

  • Therapeutic Applications: MscL-containing liposomes could potentially be used for targeted delivery of therapeutic compounds to tissues experiencing specific mechanical forces.

These applications leverage the unique properties of MscL as a mechanically-gated channel with a large conductance, making it suitable for applications requiring controlled transport of relatively large molecules across membranes .

What are the optimal conditions for reconstituting purified recombinant P. fluorescens MscL into liposomes for functional studies?

Reconstituting purified MscL into liposomes for functional studies requires careful optimization of several parameters:

Recommended Protocol:

  • Lipid Composition:

    • Asolectin liposomes have been successfully used for MscL reconstitution

    • A mixture of E. coli polar lipids (70%) and phosphatidylcholine (30%) is often effective

    • Maintaining native-like membrane thickness is critical for proper function

  • Protein-to-Lipid Ratio:

    • Optimal ratios typically range from 1:50 to 1:500 (w/w)

    • Lower ratios (1:200 to 1:500) are preferred for single-channel recordings

    • Higher ratios (1:50 to 1:100) may be used for ensemble measurements

  • Reconstitution Method:

    • Detergent-mediated reconstitution with gradual detergent removal is most common

    • Detergents like n-Dodecyl-β-D-maltoside (DDM) or Triton X-100 are typically used

    • Detergent removal via Bio-Beads or dialysis should be performed gradually at 4°C

  • Buffer Conditions:

    • Tris-based buffers (20 mM Tris-HCl, pH 7.5) with 150-200 mM NaCl

    • Addition of glycerol (10-20%) can improve protein stability

  • Quality Control:

    • Liposome size and homogeneity should be verified by dynamic light scattering

    • Protein incorporation should be confirmed by freeze-fracture electron microscopy

    • Functional verification via patch-clamp electrophysiology is essential

This approach preserves the native lipid-protein interactions critical for MscL function, as emphasized in studies highlighting the importance of the lipid environment for proper channel activity .

How can researchers troubleshoot expression issues with cysteine mutants of MscL?

Troubleshooting expression issues with cysteine mutants of MscL requires systematic analysis of several factors:

Common Issues and Solutions:

  • Reduced Expression Levels:

    • Several positions in MscL (e.g., residues 22, 26, 43, 72, 76, 78, 92, and 95) have shown moderate to severe reduction in expression levels when mutated to cysteine

    Solutions:

    • Adjust induction conditions (lower IPTG concentration, reduced temperature)

    • Use specialized expression strains (e.g., C41(DE3) or C43(DE3) for toxic proteins)

    • Optimize codon usage for the expression host

    • Add stabilizing agents to growth media (e.g., sorbitol, glycerol)

  • Protein Misfolding:

    • Cysteine mutations can disrupt disulfide bond formation or protein folding

    Solutions:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Use fusion partners that enhance solubility (MBP, SUMO, TrxA)

    • Express at lower temperatures (16-20°C)

    • Include mild solubilizing agents in lysis buffer

  • Oxidation Issues:

    • Free cysteines can form aberrant disulfide bonds

    Solutions:

    • Include reducing agents (DTT, β-mercaptoethanol) in buffers

    • Perform purification under nitrogen atmosphere when possible

    • Use degassed buffers containing EDTA to prevent metal-catalyzed oxidation

  • Functional Assessment:

    • Verify that E. coli growth rates remain unchanged, suggesting no significant gain-of-function effects that could be toxic to cells

    • Conduct patch-clamp analysis to confirm channel functionality

By systematically addressing these issues, researchers can improve the expression and functionality of cysteine mutants of MscL for structural and functional studies .

What analytical methods are most effective for verifying the structural integrity of purified recombinant MscL?

Multiple complementary analytical methods are recommended for comprehensive verification of MscL structural integrity:

Biophysical Characterization Methods:

MethodInformation ProvidedSample RequirementsAdvantagesLimitations
Circular Dichroism (CD)Secondary structure content0.1-0.5 mg/ml, 200-300 μlRapid assessment of folding, minimal sampleLow resolution, no tertiary structure
Size Exclusion Chromatography (SEC)Oligomeric state, homogeneity0.5-1 mg proteinDetects aggregation, oligomeric stateLimited resolution between similar states
Dynamic Light Scattering (DLS)Size distribution, aggregation0.1-1 mg/ml, 50-100 μlSensitive to aggregation, small sampleCannot distinguish specific conformations
EPR SpectroscopyLocal environment, accessibilitySpin-labeled proteinNative-like conditions, dynamicsRequires site-specific labeling
Mass SpectrometryExact mass, modifications10-100 μg proteinHigh accuracy, detects modificationsLimited structural information
Thermal Stability AssaysProtein stability, ligand binding1-10 μg proteinHigh-throughput, small sampleIndirect measurement of structure

Functional Verification:

  • Reconstitution in Liposomes: Essential to verify that the purified MscL can be properly incorporated into lipid bilayers.

  • Patch-Clamp Electrophysiology: The gold standard for functional verification, confirming that the channel conducts ions and responds to membrane tension with the expected conductance (~3 nS for fully open MscL).

  • Fluorescence-Based Assays: Can be used to monitor channel activity in liposomes through the release of fluorescent dyes in response to osmotic shock.

The combination of these structural and functional analyses provides a comprehensive assessment of MscL integrity. For the most rigorous characterization, researchers should employ at least one method that verifies secondary structure (CD), one that confirms the oligomeric state (SEC, native PAGE), and one functional assay (patch-clamp or fluorescence-based) .

How does P. fluorescens MscL differ structurally and functionally from well-characterized MscL channels in E. coli and M. tuberculosis?

P. fluorescens MscL shares core structural features with E. coli and M. tuberculosis MscL channels but exhibits species-specific differences that affect function:

Structural Comparison:

FeatureP. fluorescens MscLE. coli MscLM. tuberculosis MscL
Subunit OrganizationHomopentamerHomopentamerHomopentamer
Transmembrane DomainsTwo per subunit (TM1, TM2)Two per subunit (TM1, TM2)Two per subunit (TM1, TM2)
N-terminal DomainPresentPresentPresent
C-terminal DomainCytoplasmic helical bundleCytoplasmic helical bundleCytoplasmic helical bundle
Sequence IdentityReference~36% identity with M. tuberculosis MscL~36% identity with E. coli MscL
Channel Size (Closed)Similar to others~3.5 Å diameter~2 Å diameter
Channel Size (Open)~30 Å diameter~30 Å diameter~30 Å diameter

Functional Differences:

  • Tension Sensitivity: While specific data for P. fluorescens MscL is limited, variations in sequence and structure between species generally result in different tension sensitivities. These differences reflect adaptations to specific environmental pressures.

  • Gating Kinetics: The precise dynamics of channel opening and closing can vary between species due to differences in key residues at the constriction point of the pore and in the transmembrane domains.

  • Conductance: While all MscL channels exhibit large conductance (~3 nS), subtle species-specific differences exist that may relate to the physiological role of the channel in each bacterial species.

These differences highlight the evolutionary adaptations of MscL across bacterial species while maintaining the core mechanosensitive function essential for osmotic regulation .

What genetic and evolutionary insights can be gained from comparative analysis of MscL sequences across Pseudomonas species?

Comparative analysis of MscL sequences across Pseudomonas species provides valuable insights into evolutionary adaptation and functional conservation:

  • Conserved Functional Domains: Key regions essential for mechanosensing and channel function show high conservation across Pseudomonas species, including:

    • The pore-lining residues in TM1

    • The glycine-rich regions that act as flexible hinges during gating

    • The hydrophobic constriction residues that form the channel gate

  • Variable Regions: Areas with higher sequence variability indicate regions under lower functional constraint or subject to species-specific adaptations, potentially including:

    • Periplasmic loops

    • C-terminal domains

    • Lipid-facing residues in TM2

  • Adaptive Evolution: The pattern of conservation and variation suggests adaptive evolution in response to:

    • Different environmental osmotic pressures

    • Varying membrane compositions

    • Distinct ecological niches occupied by different Pseudomonas species

  • Horizontal Gene Transfer: Analysis of MscL sequences can reveal potential horizontal gene transfer events between Pseudomonas and other bacterial genera, contributing to our understanding of bacterial evolution.

  • Functional Specialization: Sequence variations may correspond to functional specialization of MscL in different Pseudomonas species, potentially relating to:

    • Different osmotic stress response thresholds

    • Varied interactions with other cellular components

    • Adaptations to specific environmental conditions

These comparative analyses enhance our understanding of structure-function relationships in MscL channels and provide insights into bacterial adaptation to mechanical stress .

How can researchers utilize cross-species functional complementation assays to study P. fluorescens MscL?

Cross-species functional complementation assays offer powerful approaches for studying P. fluorescens MscL properties and function:

Methodology and Applications:

  • Complementation in MscL-Deficient E. coli:

    • Express P. fluorescens MscL in E. coli MscL knockout strains (MJF455, MJF429)

    • Subject cells to hypoosmotic shock survival assays

    • Measure survival rates to quantify functional complementation

    • This approach reveals whether P. fluorescens MscL can functionally replace E. coli MscL

  • Chimeric Channel Construction:

    • Create chimeric channels by swapping domains between P. fluorescens MscL and well-characterized MscL proteins

    • Express these chimeras in MscL-deficient strains

    • Assess function through survival assays and patch-clamp analysis

    • This approach identifies domains responsible for species-specific functional differences

  • Site-Directed Mutagenesis Analysis:

    • Introduce mutations in P. fluorescens MscL based on known functional residues in other species

    • Express mutants in MscL-deficient strains

    • Assess impact on function and gating properties

    • This approach validates conservation of critical residues across species

  • Heterologous Expression Systems:

    • Express P. fluorescens MscL in various bacterial hosts with different membrane properties

    • Compare gating characteristics and tension sensitivity

    • This approach reveals how membrane environment affects channel function

  • Quantitative Analysis:

    • Use patch-clamp electrophysiology to measure specific functional parameters:

      • Gating threshold (tension sensitivity)

      • Channel conductance

      • Opening and closing kinetics

    • Compare these parameters between P. fluorescens MscL and other species

Through these complementation approaches, researchers can gain insights into the specific functional properties of P. fluorescens MscL, identify conserved and divergent features across species, and understand how evolutionary adaptations affect mechanosensitive channel function .

What are the most promising approaches for capturing the full conformational landscape of MscL during gating?

Several innovative approaches show promise for capturing the complete conformational landscape of MscL during gating:

  • Time-Resolved Cryo-Electron Microscopy:

    • Rapidly freezing MscL at different time points after activation

    • Using classification algorithms to identify distinct conformational states

    • This approach can potentially capture transient intermediates in the gating pathway

  • Single-Molecule FRET (smFRET):

    • Labeling specific residues in MscL with fluorophore pairs

    • Monitoring distance changes during gating in real-time

    • This provides dynamic information about protein movements at the single-molecule level

  • Advanced EPR Techniques:

    • Double Electron-Electron Resonance (DEER) spectroscopy for measuring distances between spin labels

    • Continuous Wave EPR for monitoring local environment changes

    • These approaches provide detailed information about specific structural changes during gating

  • Integrative Structural Biology:

    • Combining multiple experimental techniques (crystallography, cryo-EM, EPR, FRET)

    • Using computational methods to generate models consistent with all experimental constraints

    • This approach leverages the strengths of different methods to build a comprehensive picture

  • Native Mass Spectrometry:

    • Studies have demonstrated that MscL "has the inherent structural flexibility to achieve large global structural changes in the absence of a lipid bilayer"

    • This approach can identify distinct conformational states and their distribution

  • Molecular Dynamics Simulations with Enhanced Sampling:

    • Using advanced simulation techniques to model the complete gating process

    • Validating computational models with experimental data

    • This approach can fill gaps between experimentally determined states

These complementary approaches could collectively provide unprecedented insights into the dynamic conformational changes that occur during MscL gating, advancing our understanding of mechanosensation at the molecular level .

How might studies of P. fluorescens MscL contribute to the development of novel antimicrobial strategies?

Studies of P. fluorescens MscL could contribute to innovative antimicrobial strategies through several mechanisms:

  • MscL as a Drug Entry Pathway:

    • Research has shown that "the open pore of MscL permits entry of streptomycin and could potentially serve as a target for antimicrobial agents"

    • By understanding the specific properties of P. fluorescens MscL, researchers could develop compounds that trigger channel opening, creating an entry pathway for antibiotics

    • This approach could be particularly valuable against Pseudomonas aeruginosa, a related pathogen known for high drug resistance

  • Targeting Bacterial Osmoregulation:

    • Disrupting MscL function could compromise bacterial osmotic stress responses

    • Compounds that lock MscL in an open state would cause unregulated ion flux, potentially disrupting cellular homeostasis

    • Species-specific differences in MscL could enable selective targeting of pathogenic Pseudomonas species

  • Novel Drug Delivery Approaches:

    • Engineered liposomes incorporating MscL channels could deliver antimicrobial compounds in response to specific mechanical triggers

    • These systems could enable targeted delivery to infection sites

    • Understanding P. fluorescens MscL could inform the design of such delivery systems

  • Combination Therapies:

    • MscL-targeting compounds could potentiate traditional antibiotics by increasing membrane permeability

    • This approach could help overcome resistance mechanisms in Pseudomonas species

    • Adjuvants that modulate MscL function could lower the effective concentration of antibiotics needed

  • Immunomodulatory Approaches:

    • Research on "passive immunotherapy with antibacterial monoclonal antibodies (mAbs)" represents an alternative therapy against resistant Pseudomonas species

    • Antibodies targeting MscL could potentially interfere with bacterial stress responses

    • This strategy might be particularly valuable for immunocompromised patients

As antimicrobial resistance becomes increasingly prevalent, particularly in Pseudomonas species, novel approaches targeting conserved bacterial systems like MscL represent promising avenues for therapeutic development .

What interdisciplinary approaches could advance our understanding of MscL function in bacterial physiology and stress response?

Advancing our understanding of MscL function in bacterial physiology requires innovative interdisciplinary approaches:

  • Systems Biology Integration:

    • Combining transcriptomics, proteomics, and metabolomics to study how MscL expression and function integrate with broader cellular responses to osmotic stress

    • Network analysis to identify interactions between MscL and other stress response systems

    • This comprehensive approach would place MscL function in the context of global bacterial physiology

  • Synthetic Biology Applications:

    • Engineering bacteria with modified MscL channels to study the impact on stress tolerance

    • Creating synthetic circuits that link MscL activity to reporter systems for real-time monitoring

    • These approaches could reveal how MscL contributes to bacterial fitness under various conditions

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize MscL distribution and clustering in bacterial membranes

    • Single-particle tracking to monitor MscL dynamics in living cells

    • These techniques could reveal spatial and temporal aspects of MscL function previously inaccessible

  • Microfluidics and Single-Cell Analysis:

    • Microfluidic devices to precisely control osmotic environments while monitoring bacterial responses

    • Single-cell analysis to characterize heterogeneity in MscL expression and function

    • These approaches could reveal how MscL contributes to population-level survival strategies

  • Computational Modeling Across Scales:

    • Multi-scale modeling linking molecular dynamics of MscL to whole-cell physiological responses

    • Predictive models of how MscL function affects bacterial survival under various stress conditions

    • These computational approaches could generate testable hypotheses about MscL's role in bacterial adaptation

  • Evolutionary and Ecological Perspectives:

    • Comparative analysis of MscL function across bacteria from different ecological niches

    • Experimental evolution studies to observe adaptation of MscL under sustained osmotic stress

    • These approaches could reveal how environmental pressures shape MscL function and regulation

By integrating these interdisciplinary approaches, researchers could develop a comprehensive understanding of how MscL functions as part of the broader bacterial stress response network, potentially revealing new targets for antimicrobial development and insights into bacterial adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.