Recombinant Pseudomonas fluorescens Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant MsbA is a 601-amino acid transmembrane protein (UniProt ID: Q4KJB2) expressed in Escherichia coli with an N-terminal His-tag for purification . It belongs to the ATP-binding cassette (ABC) transporter superfamily and is encoded by the msbA gene (PFL_0527) .

PropertySpecification
Molecular Weight~67 kDa (predicted)
Expression HostEscherichia coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water with 5–50% glycerol for stability

Domain Architecture

  • Transmembrane Domain (TMD): Comprises six α-helices involved in lipid A-core binding and translocation .

  • Nucleotide-Binding Domain (NBD): Contains conserved Walker A/B motifs for ATP hydrolysis .

Key Functional Attributes

  • Lipid A Transport: Mediates the ATP-dependent flipping of lipid A-core from the cytoplasmic to periplasmic leaflet of the inner membrane, a prerequisite for LPS assembly .

  • ATPase Activity: Hydrolyzes ATP to energize transport, with activity modulated by lipid A-core phosphate groups and Zn²+ coordination .

ATPase Activation Mechanisms

  • Zn²+ Stimulation: In Pseudomonas aeruginosa MsbA (PaMsbA), Zn²+ binding to a histidine triad (H147, H248, H314) enhances ATPase activity by stabilizing NBD dimerization .

  • Substrate Specificity: Truncated lipid A-core variants with phosphate substitutions selectively stimulate ATP hydrolysis .

Antimicrobial Target

MsbA is essential for bacterial viability, making it a promising target for novel antibiotics. Inhibitors like quinolone derivatives (e.g., G907) disrupt ATPase activity and LPS transport, showing bactericidal effects .

Biochemical Assays

  • ATPase Activity Assays: Used to screen inhibitors (e.g., IC₅₀ of 5 nM for compound G247) .

  • Native Mass Spectrometry: Measures lipid binding affinities and conformational dynamics .

Comparative Analysis with Homologs

FeatureP. fluorescens MsbAE. coli MsbAP. aeruginosa MsbA
Zn²+ DependencyNot reportedMg²+-dependent ATPase Zn²+-dependent ATPase
Cross-ComplementationNot functional in E. coliNon-functional in P. aeruginosa N/A
Inhibitor SensitivityUntestedSensitive to G907 Zn²+ chelation reduces activity

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize fulfilling your request.
Synonyms
msbA; Pfl01_0481; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain Pf0-1)
Target Names
msbA
Target Protein Sequence
MTDSSPAASPSSLKIYFRLLGYVRPYISLFLISIVGFLIFASTQPMLGYILKYFVDGLSN PEAVLFPTVPYLRDLQLLQAVPLLIILIAAWQGLGSYLGNYFLAKVSLGLVHDLRVQLFN NLLVLPNRYFDKHNSGHLISRITFNVTMVTGAATDAIKVVIREGMTVIFLFASLLFMNWK LTLVMVAILPLIAVMVRTASKKFRKQSKKIQLAMGDVTHVASETIQGYRVVRSFGGEAYE EKRFLDASQGNTDKQLRMTRTGAIYTPLLQLVIYSAMAILMFLVLYLRGDASAGDMVAYI TLAGLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEPEVDTGTVERDSVSGRLDVRNLS FTYPGTERQVLDDISFSVEPGQMVALVGRSGSGKSTLANLIPRFYHHDKGEILIDGVEVE QYKLLNLRRHIAQVTQHVTLFSDTVANNIAYGDLAGAPREDIEKAARDAYAMDFIAQLPE GLDTQVGENGVLLSGGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDQVMK GRTTLVIAHRLSTIEKADLILVMDQGRIVERGTHDDLLAQNGYYARLNAMGLDAPAEDIA
Uniprot No.

Target Background

Function
This protein plays a role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of MsbA in gram-negative bacteria?

MsbA functions as an essential ATP-binding cassette transporter that carries out the first crucial step in trafficking lipopolysaccharide (LPS) to the outer membrane of gram-negative bacteria . It specifically transports lipid A and LPS from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane, which is a vital process for bacterial envelope biogenesis . This transport function is essential for bacterial viability, as demonstrated by conditional knockout studies where depletion of MsbA leads to accumulation of lipid A in the inner membrane, cessation of growth, and eventually cell death . The essential nature of MsbA has been confirmed both in vitro in laboratory conditions and in vivo in animal infection models, where bacteria lacking functional MsbA show significant attenuation .

How does the structure of MsbA facilitate its lipid flipping function?

The X-ray crystallography structure of MsbA from Salmonella typhimurium at 2.8 Å resolution reveals an inward-facing conformation with a large amplitude opening in the transmembrane portal . This wide opening is critical as it allows bulky lipid A molecules to enter the protein-enclosed transport pathway from their site of synthesis . The structure displays several key features that support a "trap and flip" model of lipid transport. Specifically, putative lipid A density has been observed inside the transmembrane cavity, suggesting a binding site for substrate capture . Additionally, electron density attributed to lipid A has been detected near an outer surface cleft at the periplasmic ends of the transmembrane helices, which may represent a post-transport docking site . The nucleotide-binding domains (NBDs) are separated in this inward-facing conformation, but can close upon ATP binding to drive the conformational changes needed for lipid translocation across the membrane.

What are the characteristic protein domains and motifs in P. fluorescens MsbA?

Pseudomonas fluorescens MsbA is a full-length protein of 601 amino acids that exhibits the classic architecture of ABC transporters . The protein contains several key domains:

  • Transmembrane domains (TMDs): These form the translocation pathway for lipid A across the membrane.

  • Nucleotide-binding domains (NBDs): These contain the conserved Walker A and Walker B motifs for ATP binding and hydrolysis.

  • ABC signature motif: This is characteristic of ABC transporters and is involved in ATP binding.

The amino acid sequence reveals hydrophobic transmembrane segments interspersed with hydrophilic loops, consistent with its role as a membrane protein . Analysis of the sequence also shows regions of high conservation with MsbA proteins from other gram-negative bacteria, particularly in the nucleotide-binding domains, reflecting the functional importance of these regions for ATP binding and hydrolysis that powers the transport process.

How can conditional knockout systems be designed to study MsbA essentiality?

To effectively study an essential gene like MsbA, researchers have developed sophisticated conditional knockout systems. A methodological approach involves creating a strain where the endogenous msbA open reading frame is deleted while preserving the remainder of the operon . This deletion is complemented by an arabinose-inducible copy of msbA integrated at a distant chromosomal site (such as the λ att site) . This design allows for controlled expression of MsbA based on the presence or absence of arabinose in the growth medium.

The experimental protocol involves several key steps:

  • Construction of a deletion vector targeting the msbA gene

  • Integration of an arabinose-inducible copy of msbA at a secondary chromosomal location

  • Selection for recombinants that have lost the endogenous msbA gene

  • Confirmation of arabinose-dependent growth

This system enables precise temporal control of MsbA expression. In the presence of arabinose (typically 2% w/v), MsbA is expressed at near wild-type levels, allowing normal growth . Upon removal of arabinose, MsbA protein levels decrease rapidly, becoming undetectable by Western blotting within 2 hours, thus creating a window to study the effects of MsbA depletion . This approach has been successfully implemented in both uropathogenic E. coli CFT073 and E. coli K-12 strain MG1655, demonstrating its versatility across different bacterial strains .

What structural approaches reveal the lipid A transport pathway in MsbA?

Advanced structural biology techniques have been instrumental in elucidating the lipid A transport pathway in MsbA. X-ray crystallography at high resolution (2.8 Å) combined with co-crystallization with lipid A has provided critical insights into the transport mechanism . To achieve stable protein samples suitable for crystallization, researchers have employed facial amphiphiles as stabilizing agents during protein purification .

The structural analysis reveals three key locations where lipid A interaction occurs:

  • The transmembrane portal - allowing initial entry of lipid A

  • The transmembrane cavity - where lipid A is captured during transport

  • A periplasmic cleft - potentially serving as a post-transport docking site

Comparative analysis between different MsbA structures (X-ray crystallography vs. cryo-EM, with and without bound lipid A or antagonists) has been crucial for understanding the dynamic conformational changes that occur during the transport cycle . Researchers can design experiments to capture MsbA in different conformational states by manipulating conditions such as:

  • The presence/absence of ATP or non-hydrolyzable ATP analogues

  • The presence/absence of lipid A or structural mimics

  • The use of specific mutations that lock the transporter in particular conformations

This structural information provides a foundation for rational drug design targeting MsbA function as a novel antimicrobial strategy.

How does MsbA depletion affect bacterial cell morphology and physiology?

The depletion of MsbA leads to profound changes in bacterial cell morphology and physiology that can be studied through various microscopy and biochemical techniques. Upon MsbA depletion, bacteria undergo a characteristic series of changes:

  • Initial growth arrest: OD600 measurements show minimal increase after MsbA depletion

  • Loss of viability: CFU counts begin to decrease approximately 2 hours after MsbA depletion

  • Dramatic morphological changes: Confocal microscopy reveals progressive increase in cell size over time

These phenotypic changes correlate with the biochemical consequences of MsbA depletion, particularly the accumulation of lipid A in the inner membrane. The increase in cell size may result from the disruption of envelope integrity and altered osmotic pressure regulation. Researchers can track these changes using:

  • Time-course microscopy with membrane-specific dyes

  • Electron microscopy to examine ultra-structural changes

  • Biochemical fractionation to track lipid A accumulation in different membrane compartments

  • Live/dead staining to assess membrane permeability and cell viability

These approaches provide valuable insights into the physiological consequences of disrupting essential lipid transport pathways and can inform antimicrobial development strategies.

What expression systems are optimal for producing recombinant P. fluorescens MsbA?

The expression of membrane proteins like MsbA presents significant challenges due to their hydrophobic nature and complex folding requirements. For P. fluorescens MsbA, several expression systems can be employed, each with specific advantages:

  • E. coli-based expression systems:

    • BL21(DE3) strains with pET or pBAD vectors allow controlled expression

    • C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

    • Codon-optimized constructs improve expression in heterologous hosts

  • Homologous expression in Pseudomonas:

    • Expression in P. fluorescens itself may improve proper folding

    • Pseudomonas-compatible vectors with inducible promoters (tac, T7-lac) are available

The full-length MsbA protein (601 amino acids) should be expressed with appropriate purification tags (His, FLAG, etc.) that do not interfere with function . For structural studies, it's critical to maintain the native conformation during expression and purification, which may be facilitated by expression at lower temperatures (16-20°C) and the use of specialized detergents or amphipols during membrane extraction and purification.

What are the most effective purification strategies for obtaining active MsbA protein?

Purification of active MsbA requires careful consideration of detergent selection and purification conditions to maintain the native structure and function of this membrane protein. A systematic purification strategy includes:

  • Membrane extraction:

    • Gentle cell lysis preserving membrane integrity

    • Membrane isolation through differential centrifugation

    • Solubilization using mild detergents (DDM, LMNG, or facial amphiphiles)

  • Affinity chromatography:

    • IMAC (immobilized metal affinity chromatography) for His-tagged constructs

    • All buffers should contain detergent above critical micelle concentration

  • Size exclusion chromatography:

    • Final purification step to ensure homogeneity

    • Allows assessment of oligomeric state (MsbA functions as a dimer)

  • Storage considerations:

    • 50% glycerol stabilizes the protein during freeze-thaw cycles

    • Storage at -20°C (short-term) or -80°C (long-term)

    • Aliquoting prevents repeated freeze-thaw cycles

Activity of the purified protein can be assessed through ATPase assays, which measure the ATP hydrolysis rate in the presence and absence of lipid A substrates. Proper folding can be evaluated using circular dichroism spectroscopy to analyze secondary structure content.

How can ATPase activity assays be optimized for MsbA functional studies?

ATPase activity is a critical parameter for assessing MsbA function, as ATP hydrolysis powers the conformational changes required for lipid A transport. Optimized ATPase assays for MsbA include:

  • Colorimetric phosphate detection:

    • Malachite green assay measures released inorganic phosphate

    • Requires careful background subtraction for detergent-solubilized samples

  • Coupled enzyme assays:

    • NADH-coupled assay (pyruvate kinase/lactate dehydrogenase system)

    • Allows real-time continuous monitoring of ATP hydrolysis

Experimental considerations for accurate measurements include:

  • Temperature control (typically 37°C for physiological relevance)

  • Buffer composition (pH, ionic strength)

  • Detergent concentration and type

  • Presence of potential activators (lipid A, phospholipids)

  • ATP concentration range for kinetic parameter determination

The addition of purified lipid A can stimulate MsbA ATPase activity, providing evidence for substrate-coupled ATP hydrolysis. Careful titration experiments can determine the concentration-dependence of this stimulation, yielding insights into the binding affinity between MsbA and its substrate.

How can researchers address challenges in interpreting structural data from different MsbA conformational states?

Interpreting structural data for dynamic transporters like MsbA presents unique challenges due to multiple conformational states that exist during the transport cycle. Researchers should consider:

  • Conformational heterogeneity:

    • MsbA exists in multiple conformations from wide-open inward-facing to closed outward-facing states

    • Different techniques (X-ray vs. cryo-EM) may capture different states

    • Crystal packing forces may stabilize non-physiological conformations

  • Integrative approach for data interpretation:

    • Cross-validate findings across multiple structural techniques

    • Combine structural data with biochemical and functional assays

    • Use molecular dynamics simulations to model conformational transitions

  • Resolution considerations:

    • Higher resolution structures (e.g., 2.8 Å) provide more reliable information about specific interactions

    • Lower resolution features (e.g., lipid A density) require careful interpretation

    • Validation through mutagenesis of putative interaction sites

  • Conformational stabilization:

    • Use of ATP analogs (AMPPNP, ATPγS) to capture specific states

    • Selection of appropriate detergents or nanodiscs to maintain native-like membrane environment

    • Engineering disulfide bonds to trap specific conformations for validation

By integrating data from multiple sources and carefully controlling experimental conditions, researchers can build a comprehensive model of the MsbA transport cycle that accounts for all observed conformational states.

What are potential reasons for discrepancies in MsbA phenotypes between different bacterial species?

While MsbA is essential across gram-negative bacteria, phenotypic differences in conditional mutants or upon inhibition may be observed between species. Researchers should consider several factors when interpreting these differences:

  • Species-specific LPS/lipid A structures:

    • Different bacteria produce structurally distinct lipid A molecules

    • Variations in acylation patterns, phosphorylation, and additional modifications

    • These structural differences may affect MsbA substrate recognition and transport efficiency

  • Redundancy in transport systems:

    • Some species may have partial functional redundancy or compensatory mechanisms

    • Related ABC transporters might partially complement MsbA function in certain contexts

  • Growth conditions influence:

    • Temperature sensitivity of mutants may vary between species

    • Media composition can affect the severity of MsbA depletion phenotypes

    • Growth phase considerations (log vs. stationary)

  • Experimental design variations:

    • Different methods of gene depletion (arabinose regulation vs. temperature-sensitive mutants)

    • Timing of measurements relative to depletion initiation

    • Assay sensitivity differences

When comparing MsbA studies across bacterial species, researchers should carefully account for these variables and perform controlled comparative experiments when possible to distinguish species-specific differences from methodological variations.

How can researchers differentiate between direct and indirect effects when studying MsbA inhibition?

When studying MsbA inhibition, either through genetic depletion or small molecule inhibitors, distinguishing direct effects from secondary consequences presents a significant challenge. Methodological approaches to address this include:

  • Time-course analysis:

    • Track changes chronologically after MsbA depletion/inhibition

    • Early effects (0-2 hours) are more likely to be direct consequences

    • Later effects may represent cascade responses to initial disruption

  • Biochemical verification:

    • Directly measure lipid A accumulation in the inner membrane

    • Monitor LPS transport to outer membrane using labeled precursors

    • Assess ATPase activity inhibition in purified systems

  • Complementation studies:

    • Express wild-type MsbA to rescue phenotypes

    • Test structurally related transporters for ability to complement

    • Use point mutations affecting specific functions (e.g., ATP binding but not lipid binding)

  • Correlated phenotypic analysis:

    • Compare phenotypes with other LPS transport pathway mutants (LptA-G)

    • Examine other ABC transporter inhibition phenotypes as controls

    • Use conditional lethal suppressor mutations (e.g., in LPS biosynthesis) to verify mechanism

Through these approaches, researchers can build a causal model that distinguishes primary effects of MsbA inhibition from downstream consequences, providing clearer insights into the essential functions of this transporter in bacterial physiology.

What are promising approaches for developing selective inhibitors targeting P. fluorescens MsbA?

The essential nature of MsbA makes it an attractive antimicrobial target, particularly for developing agents against Pseudomonas species. Several strategic approaches show promise:

  • Structure-guided inhibitor design:

    • Target the ATP binding site with non-hydrolyzable analogs

    • Design molecules that interfere with the lipid A binding pocket

    • Develop compounds that lock MsbA in non-productive conformations

  • High-throughput screening approaches:

    • ATPase activity inhibition assays using purified P. fluorescens MsbA

    • Whole-cell screening with conditional MsbA mutants as sensitized backgrounds

    • Fluorescence-based transport assays using lipid A analogs

  • Species-selectivity considerations:

    • Exploit structural differences between human ABC transporters and bacterial MsbA

    • Target regions unique to Pseudomonas MsbA compared to other bacterial homologs

    • Design inhibitors that interact with species-specific residues identified through sequence alignment

  • Combination approaches:

    • Identify synergistic interactions between MsbA inhibitors and existing antibiotics

    • Target multiple steps in the LPS transport pathway simultaneously

    • Explore outer membrane permeabilizers to enhance access to MsbA

Development of selective inhibitors requires careful consideration of drug-like properties, including solubility, membrane permeability, and stability, alongside target selectivity to minimize effects on human ABC transporters.

How might comparative studies between MsbA homologs advance our understanding of substrate specificity?

Comparative studies between MsbA homologs from different bacterial species offer valuable insights into the molecular basis of substrate specificity and transport mechanism:

  • Sequence-structure-function analyses:

    • Align sequences from diverse species (E. coli, Pseudomonas, Salmonella)

    • Identify conserved residues likely essential for core functions

    • Highlight variable regions potentially involved in species-specific substrate recognition

  • Domain swapping experiments:

    • Generate chimeric proteins with domains from different species

    • Test functionality using complementation of conditional lethal mutants

    • Assess substrate preference changes in reconstituted systems

  • Directed evolution approaches:

    • Apply selective pressure for transport of non-native substrates

    • Sequence evolved variants to identify critical adaptation mutations

    • Model structural changes that confer altered specificity

  • Heterologous expression studies:

    • Express MsbA homologs in a common host background

    • Compare functional parameters (ATPase activity, substrate stimulation)

    • Assess cross-species complementation capabilities

These comparative approaches would help define the molecular determinants of lipid A recognition, potentially revealing conserved mechanisms that could be targeted for broad-spectrum antimicrobial development as well as species-specific features that might enable selective targeting.

What techniques might reveal the complete conformational cycle of MsbA during lipid transport?

Understanding the complete conformational cycle of MsbA during lipid transport requires advanced biophysical techniques that can capture dynamic structural changes. Promising approaches include:

  • Time-resolved cryo-EM:

    • Rapidly freeze samples at different time points after ATP addition

    • Capture transient intermediates in the transport cycle

    • Combine with classification algorithms to sort conformational states

  • Single-molecule FRET:

    • Introduce fluorophore pairs at strategic positions in MsbA

    • Monitor distance changes in real-time during substrate transport

    • Correlate with ATP binding, hydrolysis, and release events

  • Hydrogen-deuterium exchange mass spectrometry:

    • Probe solvent accessibility changes during the transport cycle

    • Identify regions undergoing conformational dynamics

    • Map interface changes between domains during substrate transport

  • EPR spectroscopy:

    • Site-directed spin labeling at key positions

    • Measure distances and dynamics between labels

    • Characterize flexibility and rigidity of different domains during transport

  • Integrative structural biology:

    • Combine multiple data sources (X-ray, cryo-EM, SAXS, FRET)

    • Develop computational models of the complete transport cycle

    • Validate through targeted mutagenesis of residues involved in specific steps

These techniques, applied to purified MsbA in lipid environments mimicking the native membrane, would provide unprecedented insights into the molecular mechanics of lipid flipping and advance our understanding of ABC transporter function more broadly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.