Recombinant Pseudomonas fluorescens NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas fluorescens NADH-quinone Oxidoreductase Subunit A (nuoA)

NADH-quinone oxidoreductase subunit A (nuoA) is a component of the NADH-quinone oxidoreductase, also known as complex I or NDH-1, which is a crucial enzyme complex in the respiratory chain of many organisms . In Pseudomonas fluorescens, as in other bacteria, NDH-1 catalyzes the transfer of electrons from NADH to quinones, coupled with the translocation of protons across the cytoplasmic membrane . This process contributes to the generation of a proton electrochemical gradient, which is essential for energy conservation in the form of ATP .

Biological Function and Properties

The primary function of NADH-quinone oxidoreductase subunit A (nuoA) is its involvement in oxidoreductase activity, specifically acting on NADH or NADPH . NDH-1, which includes NuoA, functions by shuttling electrons from NADH, through flavin mononucleotide (FMN) and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain . It is believed that ubiquinone is the immediate electron acceptor for this enzyme in P. fluorescens . The enzyme couples the redox reaction to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy in a proton gradient .

Role in Bacterial Respiration

NADH-quinone oxidoreductase is part of both the aerobic and anaerobic respiratory chains in the cell . In E. coli, NDH-1 is essential for anaerobic respiration of NADH, using fumarate or dimethyl sulfoxide (DMSO) as terminal electron acceptors, suggesting its ability to transfer electrons to menaquinone .

Inhibitor-Binding Site

NADH-quinone oxidoreductases are inhibited by various compounds, including rotenone, piericidin A, bullatacin, and pyridaben . Photoaffinity labeling studies have identified the NQO6 subunit (the bacterial counterpart of the mitochondrial PSST subunit) as a target for these inhibitors . The PSST subunit and its bacterial counterpart have conserved cysteine motifs and are located at the interface between the hydrophilic extramembrane portion and the hydrophobic intermembrane region . It is proposed that PSST or NQO6 is directly associated with iron-sulfur cluster N2 and serves as a conduit in the transfer of electrons to quinone .

Resistance to Complex I Inhibition

Research has demonstrated that a single-subunit NADH-quinone oxidoreductase can confer resistance to mammalian nerve cells against complex I inhibition .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Pfl01_3603; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain Pf0-1)
Target Names
nuoA
Target Protein Sequence
MPEATGLMAHNWGFAIFLLGVVGLCAFMLGVSSLLGSKAWGRSKNEPFESGMLPTGGARL RLSAKFYLVAMLFVIFDIEALFLFAWSVSVRESGWTGFVEALVFIAILLAGLVYLFRVGA LDWAPEARRKRQAKLKQ
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase (NUO) in Pseudomonas species?

NADH-quinone oxidoreductase (NUO) is one of three NADH dehydrogenases found in Pseudomonas species. It functions at the beginning of the respiratory chain, accepting electrons from NADH and transferring them to the quinone pool. NUO is distinct from the other two NADH dehydrogenases (NQR and NDH2) in that it conserves energy by coupling electron transfer to ion translocation across the cell membrane, contributing to an electrochemical membrane gradient . The complex plays a crucial role in energy production systems and respiratory flexibility, particularly in adapting to different environmental conditions.

NUO is a multi-subunit enzyme complex composed of several protein components, including the nuoA subunit. In Pseudomonas species, the NUO complex is involved in:

  • Energy conservation through ion pumping across the membrane

  • Adaptation to different oxygen concentrations

  • Supporting growth under various environmental conditions

  • Contributing to virulence in certain infection models

What is the specific function of nuoA within the NADH-quinone oxidoreductase complex?

The nuoA subunit is an integral membrane protein component of the NUO complex. It contributes to the structural integrity of the complex and participates in the proton-pumping mechanism. Specifically, nuoA:

  • Anchors the peripheral subunits to the membrane domain

  • Forms part of the proton translocation pathway

  • Contributes to the assembly and stability of the entire NUO complex

  • May be involved in quinone binding and interactions with other membrane components

The nuoA subunit works in concert with other NUO subunits to facilitate electron transfer from NADH to quinone while simultaneously pumping protons across the membrane, thereby contributing to the proton motive force used for ATP synthesis.

How does the NUO complex differ from other NADH dehydrogenases in Pseudomonas species?

Pseudomonas species possess three distinct NADH dehydrogenases (NUO, NQR, and NDH2), each with unique properties:

FeatureNUONQRNDH2
Subunit compositionMulti-subunit complex6 subunitsSingle subunit
Energy conservationYes (H⁺ pumping)Yes (Na⁺ pumping)No
Ion specificityH⁺Na⁺None
Relative activity in P. aeruginosaLowest of the threeHighest during exponential phaseIntermediate
Role in virulenceRequired for anaerobic growth and virulence in some modelsDeletion increases pyocyanin production and virulenceInvolved in NADH/NAD⁺ ratio balancing
Substrate specificityNADHNADHNADH

The presence of these three parallel enzymes confers resilience to Pseudomonas energy production systems . While NQR appears to be the most active NADH dehydrogenase during exponential growth in rich medium, all three enzymes contribute to total NADH dehydrogenase activity. Interestingly, deletion of NQR in P. aeruginosa leads to increased production of the virulence factor pyocyanin and enhanced killing efficiency in macrophage and mouse infection models .

What expression systems are most suitable for producing functional recombinant nuoA?

Selecting an appropriate expression system is crucial for obtaining functional recombinant nuoA protein. Based on the literature and experimental evidence, the following systems have proven effective:

E. coli-based expression systems:

  • BL21(DE3) strain with pET vector systems for high-level expression

  • C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • LOBSTR strains for reducing background contamination during purification

Pseudomonas-based expression systems:

  • Homologous expression in P. fluorescens using arabinose-inducible promoters (similar to the pHERD system used for NQR in P. aeruginosa)

  • Heterologous expression in other Pseudomonas species like P. putida

The arabinose-inducible system demonstrated for NQR expression in P. aeruginosa offers a viable approach for nuoA expression . This system allows for controlled induction with 0.2% (w/v) arabinose and can be validated using Western blotting with anti-histidine tag antibodies if a histidine tag is incorporated into the recombinant protein design.

What are the most effective methods for purifying recombinant nuoA protein?

Purification of membrane proteins like nuoA requires specialized approaches:

  • Membrane isolation and protein extraction:

    • Grow cells to appropriate density and harvest by centrifugation

    • Resuspend in buffer containing protease inhibitors (e.g., PMSF) and DNase I

    • Lyse cells using French press (80 psi) or other mechanical disruption method

    • Remove cell debris by centrifugation at ~6,000 × g for 30 minutes

    • Collect membranes by ultracentrifugation at ~185,000 × g for 5+ hours

  • Solubilization and purification:

    • Solubilize membranes with appropriate detergents (n-dodecyl-β-D-maltoside or digitonin are often effective)

    • Use affinity chromatography (Ni-NTA for His-tagged proteins)

    • Apply additional purification steps such as ion exchange or size exclusion chromatography

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • BCA assay for protein concentration determination

    • Functional assays to verify activity

When designing the purification strategy, incorporating a polyhistidine tag (as demonstrated for NQR) facilitates purification using nickel affinity chromatography while maintaining protein function .

How can protein solubility issues be addressed when expressing recombinant nuoA?

Membrane proteins like nuoA often present solubility challenges. Several strategies can improve solubility:

  • Fusion partners:

    • MBP (maltose-binding protein) tag can enhance solubility

    • SUMO fusion improves folding and solubility

    • Thioredoxin fusion for disulfide bond formation

  • Expression conditions:

    • Lower temperature (16-25°C) reduces inclusion body formation

    • Reduce inducer concentration to slow expression rate

    • Use specialized media formulations (e.g., TB or autoinduction media)

  • Co-expression strategies:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Express with other NUO subunits that interact with nuoA

    • Include rare tRNA supplementation

  • Solubilization additives:

    • Screen different detergents (CHAPS, DDM, digitonin)

    • Include stabilizing agents (glycerol, sucrose)

    • Test various pH and salt conditions

  • Genetic modifications:

    • Remove hydrophobic regions that aren't essential for function

    • Create chimeric proteins with soluble domains

    • Perform targeted mutagenesis of aggregation-prone regions

A systematic approach involving multiple strategies offers the best chance of success in obtaining soluble, functional recombinant nuoA protein.

How can enzyme activity assays be optimized for studying recombinant nuoA function?

Optimizing activity assays for nuoA requires consideration of its role within the larger NUO complex. The following approaches are recommended:

  • NADH oxidation assay:

    • Monitor NADH consumption spectrophotometrically at 340 nm (ε = 6.22 mM⁻¹ cm⁻¹)

    • Typical reaction mixture: 100 mM NaCl, 50 μM ubiquinone-1 (UQ1), 25 μg/mL membrane protein

    • Initiate reaction with 100 μM NADH and measure for 50-60 seconds

    • Include appropriate controls (heat-inactivated enzyme, no substrate)

  • Substrate specificity:

    • Compare NADH vs. deamino-NADH (dNADH) to distinguish between different NADH dehydrogenases

    • Test various quinone analogs (ubiquinone-1, ubiquinone-10, menaquinone)

  • Coupled assays:

    • Monitor proton pumping using pH-sensitive dyes or proton electrodes

    • Measure membrane potential using voltage-sensitive fluorescent probes

    • Assess ATP production in reconstituted systems

  • Optimization parameters:

    • pH optimization (typically pH 7.0-8.0)

    • Salt concentration (evaluate Na⁺ dependency)

    • Temperature (typically 25-37°C)

    • Divalent cation requirements (Mg²⁺, Ca²⁺)

What controls should be included when measuring nuoA-related NADH dehydrogenase activity?

Proper controls are essential for accurate assessment of nuoA function:

  • Negative controls:

    • Heat-inactivated enzyme preparation

    • Reaction mixture without enzyme

    • Reaction mixture without substrate (NADH or quinone)

    • Membranes from nuoA knockout strain

    • Specific inhibitors of NUO (rotenone, piericidin A)

  • Positive controls:

    • Purified intact NUO complex

    • Commercial NADH dehydrogenase

    • Membranes from wild-type strain

  • Specificity controls:

    • Compare NADH vs. dNADH (deamino-NADH) oxidation

    • Test NQR-specific inhibitor (2-n-heptyl-4-hydroxyquinoline-N-oxide, HQNO)

    • Test NDH2-specific inhibitor (flavone)

    • Use membranes from strains with only one NADH dehydrogenase

  • Technical controls:

    • Multiple biological replicates

    • Different protein concentrations to ensure linearity

    • Time-course measurements

    • Background auto-oxidation rate of NADH

The study by Liang et al. demonstrated that different NADH dehydrogenases can be distinguished using specific substrates and inhibitors, providing a framework for developing appropriate controls .

How can site-directed mutagenesis be used to study nuoA structure-function relationships?

Site-directed mutagenesis is a powerful approach for understanding nuoA's functional domains:

  • Target selection strategies:

    • Conserved residues identified through multiple sequence alignments

    • Predicted functional domains (transmembrane regions, cofactor binding sites)

    • Residues implicated in proton translocation

    • Residues at interfaces with other NUO subunits

  • Mutation types:

    • Conservative substitutions (e.g., Asp→Glu) to maintain charge but alter size

    • Non-conservative substitutions (e.g., Asp→Ala) to eliminate function

    • Cysteine scanning mutagenesis for accessibility studies

    • Introduction of reporter groups (fluorescent amino acids)

  • Functional analysis of mutants:

    • NADH:ubiquinone oxidoreductase activity assays

    • Growth phenotypes under different conditions

    • Proton pumping efficiency

    • Complex assembly assessment

  • Structural validation:

    • Circular dichroism to confirm proper folding

    • Limited proteolysis to assess structural changes

    • Crosslinking studies to examine interfaces

    • Computational modeling of mutation effects

A systematic approach might start with alanine scanning of conserved residues, followed by more specific mutations based on initial results. The activity assay described in search result (monitoring NADH oxidation spectrophotometrically at 340 nm) provides a quantitative method to assess the functional impact of these mutations.

What are the best approaches for studying nuoA in knockout and complementation studies?

Knockout and complementation studies provide insight into nuoA's physiological roles:

  • Generation of knockout strains:

    • Allelic exchange using suicide vectors

    • CRISPR-Cas9 genome editing

    • Transposon mutagenesis (similar to the approach used in P. aeruginosa)

    • Clean deletion to avoid polar effects on downstream genes

  • Phenotypic characterization:

    • Growth curves in different media and conditions

    • NADH dehydrogenase activity measurements

    • Respiratory chain function assessment

    • Virulence and biofilm formation assays

  • Complementation strategies:

    • Chromosomal integration vs. plasmid-based expression

    • Native promoter vs. inducible promoter (e.g., arabinose-inducible)

    • Expression level control and validation

    • Wild-type and mutant variants for structure-function studies

  • Vector selection:

    • Broad-host-range vectors for Pseudomonas (e.g., pHERD series)

    • Integration vectors for single-copy expression

    • Vectors with different selection markers

    • Vectors allowing protein tagging for detection/purification

The protocol described in search result for generating complementation strains in P. aeruginosa provides a useful template. This includes cloning the gene into an appropriate vector (like pHERD28T with chloramphenicol resistance), transforming via electroporation, and confirming expression via Western blotting.

How conserved is the nuoA subunit across different Pseudomonas species?

Understanding the conservation of nuoA across Pseudomonas species provides evolutionary insights:

Conservation analysis:

SpeciesSequence Identity to P. fluorescens nuoAKey DifferencesFunctional Implications
P. aeruginosa~80-85%Variations in membrane-spanning regionsPotentially adapted to different membrane compositions
P. putida~85-90%High conservation in functional domainsSimilar catalytic properties expected
P. syringae~80-85%Differences in loop regionsMay affect interactions with other subunits
P. taiwanensis~75-80%More divergent sequencePossible adaptation to specific environmental niches

Conserved features across all Pseudomonas species include:

  • Transmembrane domains critical for membrane anchoring

  • Residues involved in proton translocation

  • Interface regions for interaction with other NUO subunits

  • N-terminal signal sequence for membrane targeting

This high conservation suggests that nuoA plays a similar fundamental role in the NUO complex across Pseudomonas species, despite adaptations to different ecological niches.

What is the relationship between nuoA expression and bacterial virulence/biofilm formation?

The relationship between NADH dehydrogenases and virulence in Pseudomonas species is complex:

  • Evidence from P. aeruginosa studies:

    • Deletion of NQR (Δ nqrF) increased biofilm formation and pyocyanin production

    • NQR mutants showed enhanced killing efficiency in macrophage and mouse infection models

    • NUO was found to be required for anaerobic growth and virulence in some infection models

  • Potential mechanisms linking nuoA to virulence:

    • Alterations in redox balance affecting virulence factor production

    • Changes in energy metabolism influencing biofilm formation

    • Shifts in NADH/NAD⁺ ratio affecting quorum sensing

    • Modified membrane potential influencing secretion systems

  • Experimental approaches:

    • Compare biofilm formation between wild-type and nuoA mutants

    • Measure virulence factor production (e.g., pyocyanin, elastase, rhamnolipids)

    • Assess infectivity in cell culture and animal models

    • Analyze transcriptional profiles of virulence genes in response to nuoA mutation

  • Biofilm assessment methods:

    • Crystal violet staining for biomass quantification

    • Confocal microscopy for structural analysis

    • Flow cell systems for dynamic biofilm formation

    • Transcriptional reporters for biofilm-specific gene expression

The observation that deletion of one NADH dehydrogenase (NQR) in P. aeruginosa led to increased virulence suggests complex regulatory connections between respiratory enzymes and virulence pathways . Similar studies with nuoA would help determine if this subunit of the NUO complex plays a comparable role in virulence regulation.

How can isotope labeling be used to study the electron transfer mechanism in the NUO complex?

Isotope labeling provides powerful tools for studying electron transfer mechanisms:

  • Hydrogen/deuterium exchange mass spectrometry (HDX-MS):

    • Exchange rates indicate solvent accessibility and conformational changes

    • Can reveal dynamic aspects of protein function during catalysis

    • Helps identify regions involved in conformational changes during electron transfer

  • ¹³C/¹⁵N labeling for NMR studies:

    • Selective labeling of specific residues or domains

    • Measure chemical shift perturbations during catalysis

    • Determine distances between labeled sites

  • EPR with spin labels:

    • Site-directed spin labeling at strategic positions

    • Measure distances between cofactors and protein residues

    • Track electron movement through the complex

  • Kinetic isotope effects:

    • Compare reaction rates with normal vs. deuterated NADH

    • Determine rate-limiting steps in electron transfer

    • Identify involvement of specific residues in catalysis

  • ¹⁸O labeling for proton pumping studies:

    • Track oxygen exchange in water molecules during proton translocation

    • Determine stoichiometry of proton pumping

    • Identify water channels within the protein

These approaches can reveal the detailed mechanism of how electrons are transferred from NADH through the nuoA subunit and other components of the NUO complex, providing insights into the energy conversion process.

How should contradictory results in nuoA functional studies be interpreted?

When facing contradictory results in nuoA studies, consider these interpretations and approaches:

  • Source of contradictions:

    • Differences in experimental conditions (pH, temperature, salt concentration)

    • Variations in genetic background of strains

    • Methodological differences in activity measurements

    • Presence of contaminating activities

  • Reconciliation strategies:

    • Directly compare methods using identical samples

    • Test multiple conditions to identify context-dependent effects

    • Use multiple complementary approaches to measure the same parameter

    • Consider the influence of other NADH dehydrogenases

  • Case study example:

    • Torres et al. concluded that NUO and NDH2 are the primary NADH dehydrogenases in P. aeruginosa, with NQR playing a minor role

    • Liang et al. reported that NQR is the most active NADH dehydrogenase during aerobic growth

    • These contradictions were addressed through comprehensive analysis of single and double deletion mutants, revealing that all three enzymes contribute to NADH dehydrogenase activity

  • Systematic resolution approach:

    • Generate clean genetic backgrounds (complete deletions, verified by sequencing)

    • Use multiple activity assays with appropriate controls

    • Test various growth conditions and phases

    • Measure enzyme expression levels alongside activity

What statistical approaches are appropriate for analyzing nuoA enzyme kinetics data?

  • Basic kinetic parameter estimation:

    • Non-linear regression for Michaelis-Menten kinetics

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf plots

    • Enzyme inhibition models (competitive, non-competitive, uncompetitive)

  • Statistical tests for comparing conditions:

    • Student's t-test for comparing two conditions

    • ANOVA with post-hoc tests for multiple conditions

    • Repeated measures designs for time-course data

  • Experimental design considerations:

    • Minimum of three biological replicates

    • Technical replicates within each biological sample

    • Inclusion of appropriate controls

    • Sample size calculations based on expected effect size

  • Advanced kinetic analysis:

    • Global fitting of multiple datasets

    • Discrimination between kinetic models using AIC or BIC

    • Bootstrap methods for confidence interval estimation

    • Bayesian approaches for parameter estimation with priors

  • Presentation of results:

    • Report both Vmax and Km with confidence intervals

    • Include enzyme efficiency (kcat/Km) calculations

    • Present raw data alongside fitted curves

    • Report goodness-of-fit metrics (R², RMSE)

The protocol described in search result reports NADH dehydrogenase activity measurements in triplicate, which represents a minimum standard for statistical validity in enzyme assays.

What computational methods can predict the impact of nuoA mutations on NUO complex function?

Computational approaches offer powerful tools for predicting mutation effects:

  • Homology modeling:

    • Generate structural models based on related proteins (e.g., E. coli complex I)

    • Validate models using known functional data

    • Identify critical residues in structural context

  • Molecular dynamics simulations:

    • Simulate wild-type and mutant protein behavior

    • Analyze protein stability and conformational changes

    • Identify water channels and ion pathways

  • Quantum mechanical/molecular mechanical (QM/MM) methods:

    • Model electron transfer reactions at quantum level

    • Calculate energy barriers for catalytic steps

    • Predict effects of mutations on reaction energetics

  • Machine learning approaches:

    • Train models on existing mutagenesis data

    • Predict functional effects of novel mutations

    • Identify patterns not obvious from first principles

  • Network analysis methods:

    • Analyze residue interaction networks

    • Identify communication pathways within protein

    • Predict allosteric effects of distant mutations

  • Evolutionary approaches:

    • Coevolutionary analysis to identify coupled residues

    • Evolutionary conservation scoring

    • Ancestral sequence reconstruction

These computational methods can guide experimental design by identifying high-priority targets for mutagenesis and providing mechanistic hypotheses for experimental validation.

How can omics data be integrated to understand nuoA regulation in different environmental conditions?

Integrating multi-omics data provides comprehensive insights into nuoA regulation:

  • Types of omics data to integrate:

    • Transcriptomics (RNA-seq) to measure gene expression

    • Proteomics to quantify protein levels and modifications

    • Metabolomics to assess metabolic state

    • Fluxomics to measure metabolic fluxes

  • Environmental conditions to compare:

    • Aerobic vs. anaerobic growth

    • Different carbon sources

    • Various stress conditions (oxidative, nitrosative, pH)

    • Biofilm vs. planktonic growth

  • Integration methods:

    • Correlation networks between different data types

    • Pathway enrichment across multiple omics layers

    • Machine learning approaches for pattern identification

    • Genome-scale metabolic models with omics constraints

  • Key relationships to analyze:

    • Coordination between nuoA and other NUO subunits

    • Balance between different NADH dehydrogenases

    • Relationship to central carbon metabolism

    • Connections to stress response pathways

  • Validation experiments:

    • Reporter gene assays for promoter activity

    • ChIP-seq to identify transcription factor binding

    • Protein-protein interaction studies

    • Metabolic flux analysis with labeled substrates

This integrated approach can reveal the regulatory networks controlling nuoA expression and the functional importance of this subunit under different environmental conditions.

What are the most promising approaches for studying nuoA structure-function relationships at atomic resolution?

Advancing structural understanding of nuoA requires cutting-edge approaches:

  • Cryo-electron microscopy:

    • Single-particle analysis of intact NUO complex

    • Sub-tomogram averaging for membrane-embedded complexes

    • Time-resolved studies to capture different conformational states

    • Direct visualization of nuoA within the larger complex

  • X-ray crystallography:

    • Crystallization of subcomplexes containing nuoA

    • Heavy atom derivatization for phase determination

    • Use of antibody fragments to stabilize specific conformations

    • Lipidic cubic phase methods for membrane proteins

  • Solid-state NMR spectroscopy:

    • Site-specific isotope labeling

    • Distance measurements between strategic residues

    • Dynamics studies to capture motion during catalysis

    • Analysis in native-like membrane environments

  • Integrative structural biology:

    • Combining data from multiple structural techniques

    • Incorporating crosslinking and mass spectrometry

    • Molecular dynamics simulations to fill gaps

    • Evolutionary coupling analysis to validate models

  • Novel spectroscopic approaches:

    • Time-resolved FTIR for proton transfer studies

    • EPR spectroscopy with specific spin labels

    • Fluorescence resonance energy transfer (FRET) studies

    • Raman spectroscopy for conformational analysis

How can synthetic biology approaches be used to engineer nuoA for enhanced activity or novel functions?

Synthetic biology offers tools to modify nuoA for improved or new functions:

  • Protein engineering strategies:

    • Directed evolution to enhance stability or activity

    • Domain swapping with homologous proteins

    • Rational design based on structural information

    • Incorporation of non-canonical amino acids for new functions

  • Applications of engineered nuoA:

    • Improved energy efficiency in industrial strains

    • Enhanced electron transfer to non-native acceptors

    • Creation of biosensors for metabolic states

    • Development of minimal synthetic respiratory chains

  • Testing platforms:

    • Reconstitution in proteoliposomes

    • Expression in minimal bacterial chassis

    • Integration with synthetic electron transport chains

    • Coupling to artificial photosystems

  • Measurement technologies:

    • High-throughput screening of variant libraries

    • Microfluidic systems for single-cell analysis

    • Real-time monitoring of respiratory activity

    • In vivo imaging of electron transfer

This synthetic biology approach could lead to engineered Pseudomonas strains with enhanced biocatalytic capabilities or novel applications in bioelectrochemical systems and bioremediation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.