Recombinant Pseudomonas fluorescens NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Metabolism

Electron Transport and Energy Conservation
nuoK is a subunit of NDH-1, which catalyzes the transfer of electrons from NADH to quinones (e.g., ubiquinone) in the respiratory chain. This process couples redox reactions to proton translocation across the membrane, generating a proton gradient for ATP synthesis . Key features include:

  • Substrate Specificity: Preferentially oxidizes NADH over d-NADH .

  • Oxygen Sensitivity: Promoter activity of the nuo operon peaks during mid-logarithmic growth under aerobic conditions but shifts to late-log phase under hypoxia (1% O₂) .

Ecological and Pathogenic Implications
In P. fluorescens, NDH-1 contributes to root colonization efficiency, a trait critical for its role in plant growth promotion and biocontrol . Deletion of nuo genes reduces competitive colonization by ~50% compared to wild-type strains .

Biotechnological Applications

Research Use

  • Enzyme Kinetics: Recombinant nuoK enables structural and functional studies of NDH-1’s quinone-binding site and proton-pumping mechanisms .

  • Mutational Analysis: Used to dissect the roles of specific residues in electron transfer (e.g., conserved histidine or arginine residues) .

Industrial Relevance

  • Biocatalysis: Potential use in bioenergy systems for optimizing electron transport efficiency .

  • Drug Target Exploration: Insights from nuoK homologs in pathogenic Pseudomonas species (e.g., P. aeruginosa) inform antimicrobial strategies targeting bacterial respiration .

Production and Purification

Expression Systems

  • Prokaryotic Hosts: Most commonly expressed in E. coli with His tags for affinity chromatography .

  • Yield and Stability: Requires storage at -80°C with glycerol (up to 50%) to prevent aggregation .

Challenges

  • Membrane Localization: As a transmembrane protein, solubilization often requires detergents or cell-free systems .

Research Gaps and Future Directions

  • Structural Dynamics: The precise mechanism of quinone binding and proton coupling remains unresolved.

  • Pathway Engineering: Enhancing nuoK stability (e.g., via mutagenesis or fusion tags) could improve its utility in synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preferences when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; PFLU_3827; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain SBW25)
Target Names
nuoK
Target Protein Sequence
MPAIPLEHGLAVAGILFCLGLVGLMVRRNILFVLMSLEIMMNAAALAFIVAGARWGQPDG QVMFILVISLAAAEASIGLAILLQLYRRFHTLDIDAASEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. This process couples the redox reaction to proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane, thus conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of NADH-quinone oxidoreductase in Pseudomonas fluorescens?

NADH-quinone oxidoreductase (NQO) in Pseudomonas species functions as a critical enzyme in the electron transport chain, catalyzing the transfer of electrons from NADH to quinones. Similar to the characterized NQO from Pseudomonas aeruginosa, the P. fluorescens enzyme likely employs a ping-pong bi-bi steady-state kinetic mechanism involving two key steps: reduction of enzyme-bound flavin through hydride transfer from NADH, followed by hydride transfer from flavin to a quinone substrate . This enzyme plays a dual role in bacterial metabolism by detoxifying quinones and maintaining an optimal [NAD+]/[NADH] ratio that supports fatty acid catabolism, similar to what has been observed in P. aeruginosa . The nuoK subunit specifically contributes to the membrane domain of the enzyme complex, likely participating in proton translocation across the bacterial membrane.

What expression systems are most effective for producing recombinant Pseudomonas fluorescens nuoK?

The most effective expression systems for producing recombinant Pseudomonas fluorescens nuoK include E. coli, yeast, baculovirus, and mammalian cell systems, with selection dependent on research objectives . For basic characterization studies, E. coli expression systems (particularly BL21(DE3) strains) offer advantages of high yield and simplified purification. For membrane proteins like nuoK, specialized E. coli strains with modified membrane compositions may improve proper folding and insertion. Expression vectors incorporating a C-terminal or N-terminal affinity tag (His6 or GST) facilitate purification while minimizing interference with protein function. Expression conditions typically require optimization of temperature (often lowered to 16-20°C post-induction), IPTG concentration (0.1-0.5 mM), and growth media supplementation with appropriate cofactors to enhance membrane protein expression and stability.

What are the basic purification methods for recombinant nuoK protein?

Purification of recombinant nuoK protein requires specialized techniques due to its membrane-associated nature. A standard purification protocol typically includes:

  • Cell lysis using mechanical disruption (French press or sonication) in a buffer containing 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, and protease inhibitors

  • Membrane fraction isolation through differential centrifugation (low-speed centrifugation to remove debris followed by ultracentrifugation at 100,000×g to collect membranes)

  • Solubilization of membrane proteins using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at 1-2% concentration

  • Affinity chromatography using Ni-NTA resin for His-tagged proteins or glutathione sepharose for GST-tagged constructs

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Maintaining detergent concentration above critical micelle concentration throughout purification to prevent protein aggregation

This approach yields purified nuoK protein suitable for further biochemical and structural studies, with typical yields of 1-3 mg per liter of bacterial culture .

How do mutations in gating residues affect substrate binding and catalysis in NADH-quinone oxidoreductase?

The kinetic parameters from steady-state analyses further illuminate this relationship:

Enzyme Variantkcat (s-1)KNADH (μM)kcat/KNADH (M-1s-1)KBQ (μM)kcat/KBQ (M-1s-1)
Wild-type~24LowHigh~24~1 × 106
Q80G~24Increased≤5-fold decrease~24~1 × 106
Q80L~24Increased≤5-fold decrease~24~1 × 106
Q80E~24Increased≤5-fold decrease~24~1 × 106

These findings indicate that distal gating residues primarily modulate substrate access to the active site rather than directly affecting the chemical steps of catalysis . Similar principles likely apply to P. fluorescens nuoK, where mutations in analogous gating residues would alter substrate binding affinity with potentially minimal impact on catalytic rates once substrates are bound.

What techniques are most effective for studying the electron transfer mechanisms in recombinant nuoK-containing complexes?

Several sophisticated techniques have proven effective for studying electron transfer mechanisms in recombinant nuoK-containing complexes:

  • Rapid kinetics methods: Stopped-flow spectroscopy with anaerobic conditions allows observation of flavin reduction rates upon mixing with NADH, providing insights into hydride transfer kinetics . The technique permits determination of limiting rate constants for flavin reduction (kred) and dissociation constants for substrate binding (Kd).

  • Steady-state enzyme kinetics: Monitoring NADH consumption rates at varying concentrations of both NADH and quinone substrates enables determination of kinetic parameters and mechanism elucidation. This approach revealed a ping-pong bi-bi mechanism in P. aeruginosa NQO , which is likely conserved in P. fluorescens.

  • Site-directed mutagenesis coupled with kinetic analyses: Systematic mutation of conserved residues followed by kinetic characterization helps identify amino acids critical for electron transfer pathways. For example, mutations of the Q80 gating residue in P. aeruginosa NQO demonstrated its importance in NADH binding without significantly affecting quinone binding or hydride transfer .

  • EPR spectroscopy: For identifying and characterizing paramagnetic intermediates formed during electron transfer, particularly iron-sulfur clusters and semiquinone species.

  • Protein crystallography combined with computational modeling: These approaches can capture different conformational states of the enzyme during the catalytic cycle, providing structural insights into electron transfer pathways.

These methods collectively provide a comprehensive understanding of electron transfer mechanisms within the complex, including identification of rate-limiting steps and conformational changes associated with catalysis.

How does the substrate specificity of Pseudomonas fluorescens NADH-quinone oxidoreductase compare with homologous enzymes from other bacterial species?

The substrate specificity of Pseudomonas fluorescens NADH-quinone oxidoreductase likely shares key features with homologous enzymes while exhibiting species-specific differences. Based on studies of related enzymes, P. fluorescens NQO would be expected to show:

  • Coenzyme specificity: P. fluorescens NQO likely exhibits strict specificity for NADH over NADPH, similar to P. aeruginosa NQO . This contrasts with eukaryotic homologs like NQO1, which can utilize both NADH and NADPH as substrates .

  • Quinone substrate range: The enzyme likely accepts various quinone substrates with different efficiencies. Comparative kinetic parameters for different quinones with P. aeruginosa NQO are shown below and may serve as a model for P. fluorescens enzyme behavior:

Quinone Substratekcat/Km (M-1s-1) in WTkcat/Km (M-1s-1) in mutants
1,4-benzoquinone~1 × 106~1 × 106
ToluquinoneVariableSimilar to WT
2,3-dimethoxy-5-methyl-1,4-benzoquinoneVariableSimilar to WT
JugloneVariableSimilar to WT
  • Species-specific adaptations: Variations in active site architecture and gating mechanisms likely exist between Pseudomonas species, reflecting adaptations to their specific ecological niches and metabolic requirements. These differences may manifest as altered substrate preferences or kinetic parameters while maintaining the core catalytic mechanism.

The nuoK subunit specifically may influence substrate specificity indirectly through its role in proton translocation, potentially affecting the coupling between electron transfer and proton pumping efficiency with different substrates.

What structural features of nuoK determine its integration into the membrane and interaction with other subunits?

The structural features that determine nuoK's membrane integration and subunit interactions include:

What are the optimal conditions for measuring NADH-quinone oxidoreductase activity in purified recombinant systems?

The optimal conditions for measuring NADH-quinone oxidoreductase activity in purified recombinant systems involve carefully controlled biochemical parameters:

  • Buffer composition: 50 mM potassium phosphate buffer (pH 7.0-7.5) containing 0.1-0.2% detergent (typically DDM) to maintain protein solubility .

  • Temperature and pH: Activity measurements are typically conducted at 25°C with optimal activity observed between pH 7.0-7.5 .

  • Substrate concentrations:

    • NADH: Range of 1-200 μM for kinetic characterization

    • Quinone substrates: 1-100 μM 1,4-benzoquinone or other quinones (concentrations vary based on solubility)

  • Spectrophotometric monitoring: Activity is commonly measured by monitoring NADH oxidation at 340 nm (ε = 6,220 M^-1cm^-1) using either a standard spectrophotometer for steady-state measurements or stopped-flow apparatus for rapid kinetics .

  • Anaerobic conditions: For mechanistic studies examining the reductive half-reaction, anaerobic conditions are essential to prevent oxygen from acting as an electron acceptor. This typically requires a glove box or specialized anaerobic cuvettes .

  • Controls: Appropriate controls include enzyme-free reactions to account for non-enzymatic NADH oxidation and specific inhibitors to confirm that measured activity is attributable to the target enzyme.

  • Data analysis: Kinetic data should be fitted to appropriate rate equations, such as those describing ping-pong bi-bi mechanisms, using non-linear regression software .

These conditions provide a foundation for reliable activity measurements that can be further optimized for specific experimental objectives.

How can researchers effectively study the integration of recombinant nuoK into membrane complexes?

Researchers can effectively study the integration of recombinant nuoK into membrane complexes using several complementary approaches:

These methods collectively provide a comprehensive understanding of nuoK's integration process, interaction partners, and structural contributions to the membrane domain of the NADH-quinone oxidoreductase complex.

What analytical techniques are most informative for characterizing the structure-function relationship of nuoK?

The most informative analytical techniques for characterizing the structure-function relationship of nuoK include:

  • Site-directed mutagenesis coupled with activity assays: Systematic mutation of conserved residues followed by functional characterization reveals the contribution of specific amino acids to enzyme activity. Particularly informative are mutations of:

    • Charged residues in transmembrane regions potentially involved in proton translocation

    • Conserved residues at predicted subunit interfaces

    • Residues lining potential quinone-binding sites

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique identifies regions of differential solvent accessibility during catalysis or upon substrate binding, revealing conformational changes associated with function.

  • EPR spectroscopy with site-directed spin labeling: Introduction of spin labels at specific sites enables monitoring of local conformational changes during catalysis. Distance measurements between pairs of spin labels can track dynamic rearrangements.

  • Electrophysiological methods: When reconstituted into liposomes or planar lipid bilayers, patch-clamp techniques can directly measure proton translocation activity associated with nuoK function.

  • Molecular dynamics simulations: Computational approaches based on homology models can predict conformational changes, proton pathways, and functional mechanisms when integrated with experimental data.

  • Cryo-electron microscopy: For structural characterization of nuoK within the context of larger assemblies, revealing its position and interactions within the complex.

  • Chemical modification with activity correlation: Selective modification of accessible functional groups (cysteines, lysines) followed by activity measurements can identify catalytically important residues.

These complementary approaches collectively provide insights into how nuoK's structure enables its dual roles in complex assembly and proton translocation, linking structural features to specific aspects of function.

What are the common challenges in expressing and purifying recombinant nuoK, and how can they be addressed?

Researchers frequently encounter several challenges when expressing and purifying recombinant nuoK, with effective solutions for each:

  • Poor expression levels:

    • Challenge: Membrane proteins like nuoK often express poorly in heterologous systems.

    • Solutions: Use specialized E. coli strains (C41/C43) designed for membrane protein expression; optimize codon usage for the expression host; employ weaker promoters to prevent toxic accumulation; lower induction temperature to 16-18°C; use fusion partners (MBP, SUMO) to enhance solubility.

  • Protein misfolding and aggregation:

    • Challenge: Improper folding within the membrane environment leads to inclusion body formation.

    • Solutions: Co-express with chaperones (GroEL/GroES); include chemical chaperones in growth media (4% glycerol, 1 M sorbitol); use mild solubilization conditions during purification; consider cell-free expression systems with supplied lipids or detergents.

  • Inefficient membrane extraction:

    • Challenge: Incomplete solubilization from membranes reduces yield.

    • Solutions: Screen multiple detergents systematically (DDM, LMNG, CHAPS); optimize detergent:protein ratio; extend solubilization time (4-16 hours); consider detergent mixtures rather than single detergents.

  • Protein instability during purification:

    • Challenge: nuoK may denature during purification steps.

    • Solutions: Include stabilizing agents (glycerol 10-20%, specific lipids); maintain constant detergent concentration above CMC; minimize temperature fluctuations; reduce purification duration; consider using amphipols or nanodiscs for final preparation.

  • Low purity or contamination:

    • Challenge: Co-purifying contaminants or incomplete complex dissociation.

    • Solutions: Implement multiple orthogonal purification steps; optimize washing conditions during affinity chromatography; consider on-column detergent exchange; use size exclusion chromatography as a final polishing step.

  • Loss of activity:

    • Challenge: Purified protein lacks expected enzymatic activity.

    • Solutions: Verify proper folding using circular dichroism; confirm incorporation of essential cofactors; reconstitute with specific lipids that may be required for function; optimize buffer conditions for activity assays.

These strategies significantly improve the likelihood of obtaining functionally active recombinant nuoK suitable for subsequent biochemical and structural studies.

How can researchers address data interpretation challenges when studying the kinetics of NADH-quinone oxidoreductase?

Researchers studying the kinetics of NADH-quinone oxidoreductase face several data interpretation challenges that require specific analytical approaches:

Implementation of these approaches enhances the reliability of kinetic data interpretation, leading to more accurate mechanistic models of NADH-quinone oxidoreductase function.

What strategies can researchers employ to study the proton-pumping function of nuoK in vitro?

Studying the proton-pumping function of nuoK in vitro requires specialized techniques that can detect and quantify proton translocation. Researchers can employ the following strategies:

  • Liposome reconstitution systems:

    • Purified nuoK, either alone or with interacting subunits, can be reconstituted into liposomes with controlled lipid composition.

    • Proton pumping can be monitored using pH-sensitive fluorescent dyes (such as ACMA or pyranine) entrapped within liposomes.

    • The development of a pH gradient can be measured as changes in fluorescence intensity upon addition of substrates.

  • Potentiometric methods:

    • Direct measurement of proton translocation using pH electrodes in a well-stirred reaction chamber.

    • Calculation of H+/e- stoichiometry by correlating proton translocation with electron transfer rates.

  • Patch-clamp electrophysiology:

    • For more detailed biophysical characterization, reconstituted proteoliposomes can be studied using patch-clamp techniques.

    • This approach allows direct measurement of proton currents and determination of channel-like properties.

  • Site-directed mutagenesis of key residues:

    • Systematic mutation of conserved charged residues (particularly lysine, glutamate, and aspartate) predicted to participate in proton channels.

    • Correlation of mutation effects on proton pumping versus electron transfer to identify residues specifically involved in proton translocation.

  • Ionophore controls:

    • Use of specific ionophores (such as valinomycin for K+ and CCCP for H+) to manipulate ion gradients across liposomal membranes.

    • These controls help distinguish between proton pumping and other ion transport phenomena.

  • Isotope exchange methods:

    • Measurement of proton/deuterium exchange rates using mass spectrometry to identify residues involved in proton transfer pathways.

  • Computational modeling:

    • Molecular dynamics simulations of nuoK can predict potential proton pathways and the energetics of proton transfer.

    • These models can guide experimental design and interpretation.

These complementary approaches collectively provide a detailed understanding of nuoK's proton-pumping function, its mechanism, and its integration with the electron transfer activities of the NADH-quinone oxidoreductase complex.

How might inhibitor studies of NADH-quinone oxidoreductase inform antimicrobial development against Pseudomonas species?

Inhibitor studies of NADH-quinone oxidoreductase offer significant potential for antimicrobial development against Pseudomonas species through several research pathways:

The multi-drug resistant nature of many Pseudomonas species, particularly P. aeruginosa in hospital-acquired infections , underscores the value of these studies for developing novel therapeutic strategies against these challenging pathogens.

What recent technological advances are transforming our understanding of NADH-quinone oxidoreductase structure and function?

Recent technological advances are revolutionizing our understanding of NADH-quinone oxidoreductase structure and function through several breakthrough approaches:

  • Cryo-electron microscopy advancements:

    • High-resolution structures of complete bacterial respiratory complexes are now achievable with single-particle cryo-EM.

    • These structures reveal the precise arrangement of membrane subunits including nuoK and provide insights into conformational changes associated with catalysis.

  • Native mass spectrometry:

    • This technique allows analysis of intact membrane protein complexes with preserved subunit interactions.

    • Reveals the stoichiometry and stability of subcomplexes within the larger NADH-quinone oxidoreductase assembly.

  • Single-molecule techniques:

    • FRET-based approaches at the single-molecule level capture conformational dynamics during catalysis.

    • Optical tweezers and atomic force microscopy provide insights into mechanical properties and force generation during proton pumping.

  • Time-resolved structural methods:

    • Serial femtosecond crystallography at X-ray free-electron lasers (XFELs) captures structural intermediates during catalysis.

    • Time-resolved cryo-EM approaches are beginning to visualize conformational changes in the millisecond-to-second timescale.

  • Integrative structural biology:

    • Combining multiple structural techniques (X-ray crystallography, cryo-EM, NMR, SAXS) with computational modeling to build comprehensive structural models.

    • These approaches are particularly valuable for membrane proteins like nuoK where individual techniques have limitations.

  • Advanced computational methods:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations are elucidating the precise mechanisms of electron and proton transfer.

    • Enhanced sampling techniques provide insights into rare conformational transitions essential for function.

  • In-cell structural biology:

    • Techniques such as cryo-electron tomography are beginning to visualize respiratory complexes in their native cellular environment.

    • These approaches reveal how complex organization within the membrane affects function.

These technological advances collectively provide unprecedented insights into the structure-function relationships of NADH-quinone oxidoreductase, driving new hypotheses and experimental approaches.

How might comparative genomics inform our understanding of nuoK evolution and species-specific adaptations?

Comparative genomics approaches offer powerful insights into nuoK evolution and species-specific adaptations through several analytical frameworks:

  • Phylogenetic analysis across bacterial species:

    • Construction of phylogenetic trees based on nuoK sequences reveals evolutionary relationships and potential horizontal gene transfer events.

    • Identification of conservation patterns across diverse bacterial lineages highlights functionally critical regions versus adaptable domains.

  • Selection pressure analysis:

    • Calculation of dN/dS ratios (non-synonymous to synonymous substitution rates) across nuoK sequences identifies regions under positive, negative, or neutral selection.

    • Positively selected regions often indicate species-specific adaptations to environmental niches or host interactions.

  • Coevolution of interacting subunits:

    • Correlation analysis of evolutionary rates between nuoK and other subunits reveals coevolutionary relationships.

    • Identification of compensatory mutations that maintain optimal subunit interactions despite sequence divergence.

  • Genome context analysis:

    • Examination of genomic neighborhoods surrounding nuoK genes across species reveals functional associations.

    • In Pseudomonas species, genome context analysis suggests connections between NADH-quinone oxidoreductase and fatty acid metabolism pathways .

  • Structural element conservation:

    • Mapping sequence conservation onto structural models identifies differentially conserved functional elements:

      • Highly conserved proton translocation channels

      • Variable regions potentially involved in species-specific regulation

      • Conserved interface regions for essential subunit interactions

  • Environmental adaptation signatures:

    • Correlation of sequence features with bacterial habitat characteristics (temperature, pH, oxygen availability, host association).

    • Identification of nuoK adaptations specific to pathogenic versus environmental Pseudomonas strains.

These comparative genomics approaches collectively provide a nuanced understanding of how evolutionary forces have shaped nuoK function across bacterial species, revealing both core conserved mechanisms and species-specific adaptations that may inform biotechnological applications and antimicrobial development strategies.

What are the most significant unresolved questions about nuoK function in Pseudomonas species?

Several significant unresolved questions about nuoK function in Pseudomonas species continue to challenge researchers in this field:

  • Proton translocation mechanism: The precise pathway and mechanism by which nuoK contributes to proton translocation remains incompletely understood. Which specific residues form the proton channel, and how is proton movement coupled to electron transfer between NADH and quinones?

  • Species-specific functional adaptations: How do variations in nuoK sequence between Pseudomonas species (e.g., P. fluorescens vs. P. aeruginosa) reflect adaptations to different ecological niches? Do these variations affect substrate preference, inhibitor sensitivity, or proton-pumping efficiency?

  • Regulatory mechanisms: How is nuoK expression and activity regulated in response to environmental conditions? Are there post-translational modifications that modulate its function in different metabolic states?

  • Role in virulence and biofilm formation: What is the specific contribution of nuoK-containing respiratory complexes to pathogenesis in infectious Pseudomonas species? How does it influence biofilm formation and antibiotic resistance?

  • Interaction with host immune systems: Do respiratory complexes containing nuoK interact with host immune components during infection? Could these interactions represent novel therapeutic targets?

  • Contribution to redox homeostasis: Beyond energy conservation, how does nuoK function contribute to maintaining redox balance in Pseudomonas species under various environmental stresses?

Addressing these questions will require integrative approaches combining structural biology, biochemistry, molecular genetics, and systems biology. The answers will advance our fundamental understanding of bacterial bioenergetics while potentially revealing new targets for antimicrobial development against pathogenic Pseudomonas species.

How might research on recombinant nuoK contribute to biotechnological applications beyond antimicrobial development?

Research on recombinant nuoK holds promise for diverse biotechnological applications beyond antimicrobial development:

  • Biocatalysis and green chemistry:

    • Engineered NADH-quinone oxidoreductases containing modified nuoK could serve as efficient biocatalysts for industrial redox reactions.

    • These enzymes might enable selective oxidation or reduction of compounds under mild conditions, reducing the environmental impact of chemical manufacturing.

  • Biosensor development:

    • Integration of nuoK-containing complexes into electrode surfaces could create sensitive biosensors for NADH, quinones, or specific inhibitors.

    • Such biosensors might find applications in environmental monitoring, food safety testing, or medical diagnostics.

  • Bioremediation technologies:

    • Engineered Pseudomonas strains with modified respiratory complexes might enhance degradation of environmental pollutants, particularly aromatic compounds that could serve as quinone analogs.

    • Understanding nuoK function could inform the design of more efficient bioremediation systems.

  • Bioelectronic devices:

    • Recombinant nuoK-containing complexes could be incorporated into bioelectronic interfaces that convert biological reducing power (NADH) into electrical current.

    • These bio-hybrid systems might serve as components in biofuel cells or biocomputing devices.

  • Synthetic biology applications:

    • Knowledge of nuoK structure-function relationships could inform the design of novel proton-pumping modules for synthetic biological systems.

    • Such engineered modules might enable new approaches to ATP synthesis or membrane potential generation in artificial cells.

  • Drug delivery systems:

    • Understanding the membrane integration properties of nuoK could inspire the design of novel peptide-based delivery systems that efficiently traverse biological membranes.

These diverse applications highlight how fundamental research on nuoK structure and function can translate into innovative biotechnologies with potential benefits across multiple sectors, from healthcare to environmental protection and sustainable chemistry.

What methodological innovations would most advance our understanding of NADH-quinone oxidoreductase function in Pseudomonas species?

Several methodological innovations would significantly advance our understanding of NADH-quinone oxidoreductase function in Pseudomonas species:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.