Recombinant Pseudomonas fluorescens Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Membranes

ArnE facilitates the flipping of L-Ara4N-PU, a lipid anchor modified with aminoarabinose, to the periplasmic leaflet. This process enables:

  • Lipid A Modification: Addition of L-Ara4N to lipid A, reducing membrane permeability to CAMPs .

  • Antimicrobial Resistance: Critical for Gram-negative pathogens like Pseudomonas aeruginosa and P. fluorescens to evade host immune defenses .

Comparative Analysis of ArnE Homologs

FeatureP. fluorescens ArnE P. aeruginosa ArnE
UniProt IDC3KAC9A6V1N7
Length (aa)115115
Sequence Identity67%100% (self)
FunctionL-Ara4N-PU flippaseL-Ara4N-PU flippase

Research Applications

  • Antibiotic Resistance Studies: Used to dissect mechanisms of polymyxin resistance in Pseudomonas spp. .

  • Membrane Protein Dynamics: Serves as a model for studying ABC transporter-associated flippases .

  • Biotechnological Engineering: Potential target for designing inhibitors to disrupt bacterial membrane modifications .

Key Research Findings

  • Genetic Context: The arnE gene is part of the arn operon, which includes genes for L-Ara4N biosynthesis and transport .

  • Knockout Studies: arnE mutants in P. aeruginosa show increased susceptibility to polymyxins, confirming its role in resistance .

  • Structural Insights: Molecular dynamics simulations predict a 12-transmembrane-helix topology for ArnE, typical of lipid flippases .

Future Directions

  • Crystallization Efforts: Ongoing attempts to resolve ArnE’s 3D structure for inhibitor design .

  • Synergistic Therapies: Combining ArnE inhibitors with existing antibiotics to combat multidrug-resistant infections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
arnE; Pfl01_2846; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain Pf0-1)
Target Names
arnE
Target Protein Sequence
MSLWLLLLACLLTCLGQVAQKCAVENWRGADLSWSRKWRSPWLWLALFALGSGLLVWLLV LQRLPVSVAYPMLSLNFVIITLIARFVFKEPVDVQHWFGVLLVIGGVALLGQQS
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasm to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ArnE in Pseudomonas fluorescens?

ArnE functions as a subunit of a flippase that translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane . This protein plays a critical role in bacterial outer membrane biogenesis and lipopolysaccharide biosynthesis pathways . The translocation of these specific lipid-linked intermediates is essential for bacterial cell envelope assembly and integrity, contributing to the cell's structural properties and potentially to antibiotic resistance mechanisms.

How does ArnE interact with other proteins in its functional pathway?

ArnE forms a heterodimer with another protein called ArnF to create a functional flippase complex . This heterodimeric structure is essential for its biological activity in translocating the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol substrate. The ArnE-ArnF complex is part of the larger lipopolysaccharide modification system that can alter the structure of bacterial lipopolysaccharides, potentially affecting interactions with the host environment and resistance to antimicrobial compounds.

What are the optimal expression systems for recombinant ArnE production?

The recombinant Pseudomonas fluorescens ArnE protein can be successfully expressed in Escherichia coli expression systems . For optimal expression, consider the following methodology:

  • Vector selection: Use a vector with a strong promoter compatible with E. coli, such as pET-based vectors.

  • Tags: N-terminal His-tagging has been successfully implemented for ArnE expression and subsequent purification .

  • Expression conditions: Standard E. coli expression strains such as BL21(DE3) are suitable, with induction typically performed using IPTG at concentrations between 0.1-1.0 mM when cultures reach an OD600 of 0.6-0.8.

  • Temperature: For membrane proteins like ArnE, lower expression temperatures (16-25°C) after induction can help minimize inclusion body formation.

Alternatively, P. fluorescens itself can be used as an expression host, particularly when utilizing its native ABC transporter system. The pDART vector system has been developed for P. fluorescens, which incorporates tliDEF genes encoding an ABC transporter along with a lipase ABC transporter recognition domain (LARD) . This system allows secretion of recombinant proteins into the extracellular medium, which may be advantageous for certain experimental setups.

What purification strategies are most effective for recombinant ArnE?

For His-tagged ArnE protein, the following purification protocol is recommended:

  • Cell lysis: Due to ArnE being a membrane protein, use detergent-based lysis buffers containing 1-2% non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or Triton X-100.

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins.

  • Secondary purification: Size exclusion chromatography to remove aggregates and obtain homogeneous protein.

  • Alternative approach: For ArnE fused with the LARD domain in the pDART system, hydrophobic interaction chromatography (HIC) using methyl-Sepharose columns has been effective, as the LARD contains a hydrophobic C-terminus that facilitates this purification method .

Post-purification, the protein should be stored in a buffer containing stabilizing agents. According to available data, recommended storage conditions include:

  • Storage buffer: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

  • Storage temperature: -20°C/-80°C

  • Aliquoting is necessary to avoid repeated freeze-thaw cycles, which can degrade the protein

  • For working stocks, store aliquots at 4°C for no more than one week

How can protein stability be maintained during handling and storage?

To maintain ArnE stability during handling and storage, follow these research-validated protocols:

  • For reconstitution:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Storage precautions:

    • Avoid repeated freeze-thaw cycles which significantly reduce protein stability

    • Work with aliquots rather than the entire stock

    • For short-term use, store working aliquots at 4°C for maximum one week

  • Handling during experiments:

    • Keep the protein cold during experiments when possible

    • Include protease inhibitors in buffers if degradation is observed

    • For membrane proteins like ArnE, include appropriate detergents in all buffers to maintain solubility

How can ArnE be studied in the context of antimicrobial resistance?

The ArnE protein's role in lipopolysaccharide modification suggests its potential involvement in antimicrobial resistance mechanisms. Researchers can design experiments to investigate this relationship using the following approaches:

  • Gene knockout/knockdown studies:

    • Create arnE deletion mutants in P. fluorescens using CRISPR-Cas9 or traditional homologous recombination methods

    • Compare susceptibility to various antimicrobial compounds between wildtype and mutant strains

    • Complement the mutation with recombinant arnE to confirm phenotype specificity

  • Overexpression studies:

    • Create strains overexpressing arnE and evaluate changes in antimicrobial resistance profiles

    • Use the recombinant protein expression systems described above, particularly the pDART system

  • Functional assays:

    • Develop in vitro flippase activity assays using purified recombinant ArnE-ArnF complexes reconstituted in liposomes

    • Monitor translocation of fluorescently labeled substrate analogs

    • Test inhibitors of ArnE function and correlate with antimicrobial susceptibility

  • Structural biology:

    • Perform crystallization trials or cryo-EM studies of purified ArnE-ArnF complexes

    • Identify binding sites for substrates or potential inhibitors

    • Use this information for structure-based drug design targeting this flippase

How does ArnE interact with evolutionary processes in Pseudomonas fluorescens?

P. fluorescens is known to undergo morphological diversification in response to environmental pressures. Although specific information about ArnE's role in this process is limited in the provided search results, researchers can design experiments to study its potential involvement:

  • Comparative genomics approach:

    • Analyze arnE sequence conservation across P. fluorescens strains adapted to different environments

    • Identify potential selection pressures on the gene through dN/dS analyses

    • Correlate sequence variations with phenotypic differences in membrane properties

  • Experimental evolution studies:

    • Subject P. fluorescens to long-term evolution experiments in environments with varying complexities, similar to those described in source

    • Monitor changes in arnE expression and sequence over time

    • Correlate these changes with adaptive phenotypes

  • Multi-species competition experiments:

    • Study how arnE expression changes when P. fluorescens is grown in competition with other species

    • Based on findings from source , interspecific competition increases morphological diversity in P. fluorescens communities

    • Determine if arnE contributes to this diversification through its effects on membrane composition

Species CombinationMorphological Diversity of P. fluorescensProportion of Wrinkly Spreader Morphotype
P. fluorescens aloneLowLow
P. fluorescens + OchrobactrumHighIncreased
P. fluorescens + multiple species (3-5)HighestSignificantly increased

Table 1: Effect of interspecific competition on P. fluorescens diversity based on findings from source . Similar experimental designs could be used to study arnE's role in adaptation.

What analytical methods are most suitable for studying ArnE interactions with lipid substrates?

To investigate the interactions between ArnE and its lipid substrates, researchers can employ these advanced analytical techniques:

  • Biophysical characterization methods:

    • Surface plasmon resonance (SPR) to measure binding affinities between purified ArnE and lipid substrates

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of binding

    • Fluorescence-based assays using labeled lipid analogs to track translocation activity

  • Mass spectrometry approaches:

    • Lipidomics analysis of membrane composition in wildtype versus arnE mutant strains

    • Crosslinking mass spectrometry to identify interaction interfaces between ArnE, ArnF, and their substrates

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes upon substrate binding

  • Molecular dynamics simulations:

    • In silico modeling of ArnE-lipid interactions in a membrane environment

    • Prediction of substrate binding sites and conformational changes during the flippase mechanism

    • Virtual screening of potential inhibitors targeting the ArnE-ArnF complex

How can solubility and functionality of recombinant ArnE be optimized?

As a membrane protein, ArnE presents particular challenges for maintaining solubility and functionality in recombinant systems. Researchers should consider:

  • Detergent optimization:

    • Screen multiple detergents (DDM, LDAO, CHAPS, etc.) at various concentrations

    • Evaluate protein stability in each detergent using techniques like size-exclusion chromatography

    • Consider using amphipols or nanodiscs for improved stability after initial purification

  • Expression optimization:

    • Test multiple E. coli strains specialized for membrane protein expression (C41, C43, Lemo21)

    • Evaluate different induction temperatures (16°C, 20°C, 25°C, 30°C)

    • Vary inducer concentrations to balance expression level with proper membrane insertion

  • Fusion partners:

    • Beyond His-tags, consider fusion with solubility-enhancing partners like MBP or SUMO

    • For P. fluorescens expression, the LARD system has shown success in promoting secretion

    • Design constructs with TEV or similar protease sites for tag removal if needed for activity assays

  • Functional validation:

    • Develop liposome-based assays to confirm flippase activity of purified protein

    • Use fluorescently labeled lipid analogs to monitor translocation across membranes

    • Implement negative controls using inactive mutants (identify catalytic residues through sequence analysis)

What are common pitfalls in studying ArnE function and how can they be addressed?

When investigating ArnE function, researchers should be aware of these common challenges:

  • Heterodimer formation issues:

    • ArnE functions as a heterodimer with ArnF ; expression of ArnE alone may not yield functional protein

    • Consider co-expression strategies for ArnE and ArnF using bicistronic constructs or dual plasmid systems

    • Validate complex formation using techniques like native PAGE or crosslinking followed by SDS-PAGE

  • Species-specific variations:

    • While information exists for both P. aeruginosa and P. fluorescens ArnE proteins, their sequences and functional properties may differ

    • Always confirm the exact species origin of the protein being studied

    • Consider comparative studies between orthologs if appropriate for your research question

  • Activity assay limitations:

    • Flippase activity is challenging to measure directly

    • Consider developing reporter systems that link flippase activity to a more easily measurable output

    • Use multiple complementary assays to confirm findings

  • Environmental sensitivity:

    • P. fluorescens shows significant environmental adaptability , which may affect arnE expression and function

    • Carefully control environmental conditions in experiments

    • Consider studying the protein under various growth conditions to understand its regulatory context

How can the ABC transporter systems in P. fluorescens be leveraged for ArnE studies?

P. fluorescens has endogenous ABC transporters that can be exploited for recombinant protein production and secretion . Researchers can integrate ArnE studies with these systems:

  • pDART vector utilization:

    • The pDART vector system incorporates the tliDEF genes encoding an ABC transporter along with a lipase ABC transporter recognition domain (LARD)

    • This system can be modified to express ArnE fused with LARD for secretion studies

    • The system enables both secretion and simplified purification through HIC using methyl-Sepharose columns

  • Comparative analysis with other ABC transporters:

    • Study potential functional or evolutionary relationships between the thermostable lipase ABC transporter and the ArnE-ArnF system

    • Investigate whether these systems share regulatory mechanisms or can interact functionally

  • Secretion pathway considerations:

    • Determine whether ArnE normally interacts with ABC transporters in its native context

    • Study whether modifications to the ABC transporter system can enhance ArnE production or activity

How does the morphological diversity of P. fluorescens impact ArnE function?

P. fluorescens can undergo morphological diversification, particularly in complex environments . This diversity may have implications for ArnE function:

  • Morphotype correlation studies:

    • Isolate different morphotypes of P. fluorescens (e.g., smooth morphotype vs. wrinkly spreader) from evolved populations

    • Compare arnE expression levels and protein function between morphotypes

    • Determine if membrane composition differences between morphotypes affect ArnE activity

  • Experimental evolution approach:

    • Subject P. fluorescens to evolution in environments of different complexity, as described in source

    • Track changes in arnE sequence, expression, and function over evolutionary time

    • Correlate these changes with the emergence of different morphotypes

  • Multi-species interaction impact:

    • Based on findings in source , interspecific competition increases morphological diversity in P. fluorescens

    • Investigate whether this diversity correlates with changes in arnE expression or function

    • Study how the presence of other bacterial species affects ArnE-mediated processes

What are promising approaches for developing inhibitors targeting ArnE?

Given ArnE's role in lipopolysaccharide modification and potential involvement in antimicrobial resistance, developing inhibitors could have therapeutic applications:

  • Structure-based drug design:

    • Once structural data for ArnE-ArnF is available, perform in silico screening of compound libraries

    • Focus on compounds that may interfere with heterodimer formation or substrate binding

    • Validate hits with in vitro binding and functional assays

  • High-throughput screening:

    • Develop a fluorescence-based assay for ArnE flippase activity amenable to high-throughput format

    • Screen chemical libraries for compounds that inhibit this activity

    • Perform secondary assays to confirm specificity and mechanism of action

  • Peptide-based inhibitors:

    • Design peptides based on interacting regions between ArnE and ArnF

    • Test whether these peptides can disrupt heterodimer formation

    • Optimize lead peptides for stability and membrane permeability

  • Combination approaches:

    • Test potential ArnE inhibitors in combination with existing antibiotics

    • Evaluate synergistic effects that might overcome resistance mechanisms

    • Develop dual-targeting molecules that affect both ArnE and other resistance determinants

How can advanced genetic techniques enhance our understanding of ArnE regulation?

Modern genetic techniques can provide deeper insights into ArnE regulation and function:

  • CRISPR interference (CRISPRi):

    • Develop CRISPRi systems for fine-tuned knockdown of arnE expression

    • Study the effects of varying degrees of expression reduction on phenotypes

    • Combine with transcriptomics to identify compensatory responses

  • Single-cell techniques:

    • Implement fluorescent reporters fused to the arnE promoter

    • Study cell-to-cell variability in expression using flow cytometry or time-lapse microscopy

    • Correlate expression patterns with cellular phenotypes at the single-cell level

  • Transcriptional and post-transcriptional regulation:

    • Identify transcription factors regulating arnE using ChIP-seq

    • Investigate potential small RNA regulators using RNA-seq and targeted validation

    • Study how environmental signals modulate these regulatory mechanisms

  • Synthetic biology approaches:

    • Engineer synthetic regulatory circuits controlling arnE expression

    • Create biosensors that respond to conditions affecting ArnE function

    • Develop tunable expression systems for precise control of ArnE levels in experimental settings

How conserved is ArnE structure and function across different Pseudomonas species?

ArnE proteins have been identified in multiple Pseudomonas species, including P. fluorescens and P. aeruginosa . Comparative analysis reveals:

  • Sequence conservation:

    • While differences exist, key functional regions show conservation, particularly in transmembrane domains

  • Functional conservation:

    • Both proteins are annotated with the same function: translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol from the cytoplasmic to periplasmic side of the inner membrane

    • Both form heterodimers with ArnF for functional activity

    • Both belong to the ArnE family and contain the EamA domain

  • Experimental approach for comparative studies:

    • Clone and express ArnE from multiple Pseudomonas species using identical expression systems

    • Compare biochemical properties including substrate specificity and kinetics

    • Perform complementation studies to determine functional interchangeability

What experimental systems best model the native cellular environment of ArnE?

To study ArnE in conditions that closely mimic its native environment, consider these approaches:

  • Membrane mimetic systems:

    • Reconstitute purified ArnE-ArnF complexes in liposomes composed of lipids matching P. fluorescens membrane composition

    • Use giant unilamellar vesicles (GUVs) for single-vesicle studies of flippase activity

    • Develop supported lipid bilayers with incorporated ArnE for surface-sensitive techniques

  • Cellular systems:

    • Use P. fluorescens itself as an expression host when possible, particularly with the pDART system

    • Develop fluorescent labeling strategies for visualizing ArnE localization in living cells

    • Implement inducible expression systems to control ArnE levels while maintaining the native cellular context

  • Environmental mimicry:

    • Design experimental conditions that reflect the ecological niches of P. fluorescens

    • Consider how factors like pH, temperature, and nutrient availability affect ArnE expression and function

    • Implement microfluidic systems to create controlled gradients mimicking natural environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.