Recombinant Pseudomonas fluorescens Probable intracellular septation protein A (PFL_1596)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are happy to accommodate special requests. Please specify your preferred format when placing your order, and we will make every effort to fulfill your requirements.
Note: While we strive to ship the format currently in stock, we are happy to accommodate special requests. Please specify your preferred format when placing your order, and we will make every effort to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. For dry ice shipping, please communicate your request in advance as additional fees may apply.
Note: All our proteins are shipped with standard blue ice packs by default. For dry ice shipping, please communicate your request in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; PFL_1596; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Target Names
PFL_1596
Target Protein Sequence
MKQFIDFIPLFLFFIVYKIDPRVVDLAGHEVTLGGIYSATAVLIISSLVVYGALFISQRK
LEKSQWLTLIACLVFGSLTLAFHSETFLKWKAPVVNWLFALAFIGSHFVGDRLLIKRIMG
HALTLPDPVWTRLNIAWIAFFLFCGAANLFVAFTFQSIWVDFKVFGSLGMTVLFLVGQGI
YLSRHLHDADPTTPKTED
Uniprot No.
Target Background
Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.
Database Links
KEGG: pfl:PFL_1596
STRING: 220664.PFL_1596
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
