Recombinant Pseudomonas fluorescens Probable ubiquinone biosynthesis protein UbiB (ubiB)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a particular tag type, please inform us, and we will prioritize its development.
The specific tag will be determined during the production process. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
ubiB; PFLU_0387; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-534
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain SBW25)
Target Names
ubiB
Target Protein Sequence
MKLLAVRRLFRIQRVVIRYRLDDLLFALPLPWFLLAVRYVLPWRWFPRKQLELSRGARLR
LALQDLGPIFIKFGQILSTRRDLLPEDIADELMLLQDRVPPFDSQQSMKLIEEQLGKKIS
EVFSRFDVDPLASASVAQVHAAQLKTGEEVVVKVIRPGLKPIIGQDLAWLFILARAAERF
SADARLLHPVDVVADYEKTIYDELDLLREAANASQLKRNFEGSPLLYVPQVYWDWCRPKV
LVMERIYGVQVTDLATLADQRTDMKMLAERGVEIFFTQVFRDSFFHADMHPGNIFVSTVN
PWSPQYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRVAQLHIDSGWVPAETKLNEFE
AAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQLY
PDLDLWNTAQPFLERWMRERMSPKTVLGNLHSQMEQLPHLANMTRDLLERMSQPHAKDPA
PPWKKRKDDWFLRLLGAAHLVGGVMLAIGGPLNQLGHWPAGIMVAVGVYLIVRR
Uniprot No.
Target Background
Function
This protein is likely a protein kinase regulator of UbiI activity, involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links
KEGG: pfs:PFLU_0387
STRING: 216595.PFLU0387
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
