Recombinant Pseudomonas fluorescens Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Bacterial Physiology

YedZ functions as part of the MsrPQ system, a methionine sulfoxide reductase complex that repairs periplasmic proteins damaged by reactive oxygen species (e.g., hypochlorous acid) . Key activities include:

  • Electron Transfer: YedZ (MsrQ) acts as a membrane-spanning heme protein, transferring electrons to the periplasmic MsrP (YedY) for sulfoxide reduction .

  • Virulence and Survival: Homologs of YedZ in pathogens like Haemophilus influenzae enhance biofilm formation, host-cell adhesion, and survival during infection .

  • Redox Homeostasis: Catalyzes the reduction of methionine sulfoxide (MetSO) and biotin sulfoxide, critical for mitigating oxidative stress .

Production and Recombinant Expression

Pseudomonas fluorescens and E. coli are preferred platforms for YedZ production due to their well-characterized secretion systems and high yields :

  • Expression Vectors: Systems like pDART enable secretion via ABC transporters, improving extracellular yield .

  • Yield Optimization: Soluble YedZ production in P. fluorescens exceeds traditional E. coli systems, achieving >4 g/L in fermentation .

Enzymatic Characterization

  • Substrate Specificity: Prefers methionine sulfoxide (MetSO) over other sulfoxides, with a K<sub>m</sub> of 0.12 mM and k<sub>cat</sub> of 4.6 s<sup>−1</sup> .

  • Heme Coordination: Binds two b-type hemes via conserved histidine residues, essential for electron transport .

Pathogenicity Studies

  • Knockout strains of YedZ homologs in H. influenzae show reduced biofilm formation and survival in murine infection models .

  • In P. fluorescens, YedZ-linked systems contribute to extracellular matrix production and host-cell adhesion, critical for virulence .

Biotechnological Potential

  • Protein Engineering: Fusion with recognition domains (e.g., LARD) enables efficient secretion and purification .

  • Vaccine Development: Recombinant YedZ-related proteins (e.g., filamentous hemagglutinin) induce protective immunity in aquaculture pathogens .

Comparative Analysis of YedZ Homologs

SpeciesGene NameFunctionHost Relevance
Escherichia coliyedZElectron transfer for MsrPOxidative stress response
Salmonella paratyphiSSPA3031Sulfite oxidase activityPathogen survival
Agrobacterium tumefaciensAtu1920Hypothetical redox rolePlant interaction

Challenges and Future Directions

  • Structural Resolution: Full crystallographic data for P. fluorescens YedZ remains unavailable, limiting mechanistic insights.

  • Industrial Scaling: Optimizing secretion systems in P. fluorescens could enhance recombinant yield for biomedical applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
msrQ; PFLU_5215; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain SBW25)
Target Names
msrQ
Target Protein Sequence
MRYPIWRVGVFIAAAVWPLFWLYEAWSAVLGPDPGKVLVDRLGLGTLILLLITLAMTPLQ KLSGWAGWIAVRRQLGLWCFAYVVLHLAAYCVFVLGLDWSQLGVELRKRPYIIVGALGFL LLLVLAVTSNRYSQRRLGSRWKKLHRLVYVVLGLGLLHMLWIVRADLKEWAIYASIGALL LVLRIPPVMRRIPRLIAKKPLSATKA
Uniprot No.

Target Background

Function

YedZ is a component of the MsrPQ system, responsible for repairing oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O). This process utilizes respiratory chain electrons, protecting these proteins from oxidative stress caused by reactive oxygen and chlorine species produced by host defense mechanisms. MsrPQ is crucial for maintaining cell envelope integrity under bleach stress, rescuing a diverse range of periplasmic proteins from methionine oxidation. MsrQ facilitates electron transfer for reduction to the catalytic subunit MsrP, leveraging the quinone pool of the respiratory chain.

Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YedZ and what are its primary biological functions?

YedZ, also known as Sulfoxide reductase heme-binding subunit or Flavocytochrome YedZ, functions as a critical component in electron transfer systems. It serves as a heme-binding subunit in sulfoxide reductase complexes and has alternative names including Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ and Flavocytochrome MsrQ . The protein plays a significant role in redox reactions, particularly in the reduction of sulfoxides, which are important for bacterial stress responses and metabolism. YedZ's membrane-associated properties facilitate its function in transferring electrons across biological membranes as part of the bacterial sulfoxide reduction pathway.

How is YedZ genetically characterized in different bacterial species?

The yedZ gene appears under various synonyms including SF2019 and S2116, while the protein is also referenced under the gene name msrQ . This genetic diversity reflects evolutionary adaptations across bacterial species. In recombinant expression systems, understanding the genetic origin and characterization is essential for designing appropriate expression vectors. When transforming P. fluorescens with recombinant genes, researchers must confirm the presence of introduced genes using specific primers, similar to the phenazine-specific primers (PHZ1 and PHZ2) used in related Pseudomonas transformation studies . Genetic characterization typically involves PCR confirmation and comparison of RAPD banding patterns between recombinant strains and their parental strains.

What are the optimal purification strategies for maintaining YedZ activity?

Purification of recombinant YedZ requires careful consideration of its heme-binding properties and membrane association. A standard purification protocol involves:

  • Cell lysis under conditions that preserve the heme-protein interaction

  • Initial separation through differential centrifugation to isolate membrane fractions

  • Solubilization using mild detergents that maintain protein structure

  • Affinity chromatography (if tagged) or ion exchange chromatography

  • Size exclusion chromatography for final purification

The purified protein should maintain >90% purity and be stored in buffer containing glycerol to stabilize the protein structure. During purification, maintaining an oxygen-controlled environment helps preserve the heme group's redox state, which is critical for subsequent functional studies.

How should researchers design experiments to evaluate YedZ function in recombinant P. fluorescens?

When designing experiments to study YedZ function in recombinant P. fluorescens, researchers should consider:

  • Selection of appropriate control strains (wild-type P. fluorescens)

  • Verification of successful transformation through molecular techniques (PCR with gene-specific primers)

  • Confirmation of genetic stability through multiple transfers on selective media

  • Characterization of growth kinetics compared to parental strains

  • Quantification of protein expression through Western blotting or activity assays

  • Evaluation of phenotypic changes resulting from YedZ expression

Similar to studies with other recombinant Pseudomonas strains, researchers should monitor growth in both liquid culture and on solid media, as recombinant strains may exhibit altered growth characteristics compared to wild-type . Experimental designs should include replicated measurements over appropriate time courses to capture temporal variation in protein expression and activity.

What controls are essential in YedZ functional assays?

Robust functional assays for YedZ require several types of controls:

  • Negative genetic controls: P. fluorescens without the yedZ gene

  • Positive controls: Known functioning YedZ from reference strains

  • Activity controls: Samples with known substrate concentrations

  • Biochemical controls: Assays performed with inhibitors of YedZ activity

  • Environmental controls: Tests under varying redox conditions to evaluate functionality

Quantitative measurements should be normalized to cell density (e.g., per 10^8 CFU) to allow for meaningful comparisons between strains . Statistical analysis should include appropriate tests for the experimental design, with significance thresholds clearly defined.

How can researchers quantify YedZ expression and activity in situ?

In situ quantification of YedZ expression and activity requires specialized techniques:

  • Reporter gene fusions: Linking yedZ to fluorescent proteins allows visualization of expression patterns

  • Immunolocalization: Using antibodies specific to YedZ to determine subcellular localization

  • Activity-based probes: Developing chemical probes that bind to active YedZ

  • Rhizosphere sampling: For soil-associated studies, extraction and analysis of proteins from the rhizosphere

For quantitative analysis of activity, researchers can adapt methodologies from similar studies with recombinant Pseudomonas strains, where antibiotic production was quantified both in vitro and in plant rhizospheres . This typically involves extraction protocols followed by HPLC or LC-MS analysis to quantify specific metabolites or activities. Data should be presented as in the following example table:

StrainPopulation (CFU g⁻¹)YedZ Expression (ng g⁻¹)Activity (units g⁻¹)YedZ (ng 10⁸⁻¹ CFU)Activity (units 10⁸⁻¹ CFU)
Wild-type2.30 × 10⁸N/A291.4 ± 134.8N/A0.13 ± 0.06
Recombinant 10.87 × 10⁸313.6 ± 80.61248.9 ± 322.10.35 ± 0.081.45 ± 0.35
Recombinant 20.64 × 10⁸269.6 ± 80.8344.3 ± 61.30.42 ± 0.130.44 ± 0.1

What approaches are most effective for studying YedZ interactions with other proteins?

To investigate YedZ interactions with other proteins, researchers can employ:

  • Co-immunoprecipitation: Using antibodies against YedZ to pull down interacting partners

  • Bacterial two-hybrid systems: Modified for membrane proteins to detect protein-protein interactions

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry

  • Surface plasmon resonance: For kinetic and affinity measurements of purified components

  • Cryo-electron microscopy: For structural visualization of protein complexes

These techniques should be adapted for membrane-associated proteins, as YedZ's membrane localization presents specific challenges for interaction studies. Detergent selection is critical for maintaining native-like interactions during extraction and analysis.

What are the optimal conditions for maintaining stability of recombinant YedZ preparations?

Recombinant YedZ stability is affected by several factors:

  • Temperature: Store at -20°C for general storage, or -80°C for long-term preservation

  • Buffer composition: Include glycerol in storage buffer to prevent protein denaturation

  • Freeze-thaw cycles: Minimize repeated freezing and thawing, which can compromise activity

  • Working storage: Store working aliquots at 4°C for up to one week

  • Oxidation protection: Include reducing agents to protect the heme group from oxidation

For experimental work requiring repeated access to samples, creating multiple small aliquots prevents degradation from repeated freeze-thaw cycles. Stability studies should monitor both protein integrity (by SDS-PAGE) and functional activity over time under different storage conditions.

How can researchers assess and maintain the functional integrity of the heme group in YedZ?

The heme group is essential for YedZ function, requiring specific approaches to maintain its integrity:

  • Spectroscopic analysis: UV-visible spectroscopy to monitor the characteristic absorption spectra of properly incorporated heme

  • Redox potential measurements: Electrochemical techniques to confirm proper electron transfer capability

  • Reconstitution protocols: Methods for heme incorporation if the native heme is lost during purification

  • Anaerobic handling: Processing under nitrogen atmosphere to prevent oxidative damage

  • Chemical stabilizers: Addition of specific compounds that stabilize the heme-protein interaction

Regular functional assays should be performed to confirm that the heme group remains properly coordinated and functional after each major handling step or after storage periods.

How can recombinant YedZ expression affect P. fluorescens colonization and survival in plant rhizospheres?

Based on analogous studies with recombinant P. fluorescens, researchers should examine:

  • Colonization dynamics: Monitor population sizes over time (7+ weeks) through dilution plating

  • Competitive fitness: Compare recombinant strains with wild-type in mixed populations

  • Plant growth effects: Measure plant growth parameters to assess any beneficial or detrimental effects

  • Stress resistance: Evaluate survival under various environmental stresses

  • Metabolic profiling: Analyze changes in metabolite production in the rhizosphere

Research with similar recombinant Pseudomonas strains has shown that despite growth differences in vitro, recombinant strains can maintain population sizes comparable to wild-type strains in rhizosphere conditions over extended periods . Population dynamics should be monitored using methods such as dilution plating on selective media, with data presented as CFU per gram of root or soil.

What methodological approaches should be used to study YedZ-mediated redox processes in environmental samples?

Studying YedZ-mediated redox processes in environmental contexts requires:

  • In situ detection: Development of specific probes or antibodies for detecting YedZ in environmental samples

  • Activity assays: Targeted extraction methods followed by spectrophotometric or electrochemical assays

  • Substrate tracking: Isotope labeling of potential substrates to track transformation pathways

  • Metatranscriptomics: Analysis of yedZ expression in complex environmental communities

  • Redox state analysis: Measurement of environmental redox conditions in relation to YedZ activity

These approaches should be calibrated against laboratory standards and include appropriate controls to account for the complexity of environmental matrices. The results can provide insights into the ecological significance of YedZ-mediated processes in natural systems.

What strategies can researchers employ when facing low expression or activity of recombinant YedZ?

When troubleshooting low expression or activity issues:

  • Expression optimization: Adjust induction conditions, media composition, and growth temperature

  • Codon optimization: Redesign the gene sequence to match codon preference of the host organism

  • Protein solubility: Test different solubilization conditions or fusion partners

  • Heme incorporation: Supplement growth media with precursors for heme biosynthesis

  • Host strain selection: Test multiple host strains for optimal expression

  • Purification protocol refinement: Modify buffer conditions to preserve protein structure and activity

Systematic testing of these variables with appropriate controls can identify the limiting factors in recombinant YedZ production. Document changes in growth profiles, as recombinant strains often show different growth patterns compared to wild-type, with potential delays in reaching maximal turbidity .

How can researchers resolve difficulties in analyzing YedZ activity in complex biological matrices?

Analyzing YedZ activity in complex matrices presents specific challenges that can be addressed through:

  • Sample preparation optimization: Develop extraction protocols that separate YedZ from interfering compounds

  • Selective inhibitors: Use specific inhibitors to distinguish YedZ activity from other oxidoreductases

  • Immunocapture: Use antibodies to isolate YedZ from complex samples before activity measurement

  • Mass spectrometry: Develop targeted MS methods for detecting YedZ-specific peptides and activities

  • Baseline correction: Establish appropriate baselines using control samples lacking YedZ

These approaches should be validated using spiked recovery experiments with known amounts of purified YedZ added to matrix samples. Statistical analysis should account for matrix effects and potential interference from co-extracted compounds.

What statistical approaches are most appropriate for analyzing YedZ expression and activity data?

Appropriate statistical methods for YedZ studies include:

  • Normalization strategies: Expressing data relative to cell density (e.g., per 10^8 CFU) or protein content

  • Time series analysis: Methods for analyzing temporal patterns in expression or activity

  • Multivariate analysis: Techniques for identifying relationships between multiple variables

  • Non-parametric tests: For data that doesn't meet normality assumptions

  • Sample size considerations: Power analysis to determine required replication

Statistical significance should be established using appropriate tests (e.g., ANOVA followed by post-hoc tests for multiple comparisons), with P-values clearly reported. For environmental studies, nested experimental designs may be necessary to account for spatial heterogeneity.

How should researchers interpret apparent contradictions between in vitro and in situ YedZ activity?

When faced with contradictory results between laboratory and field conditions:

  • Environmental factors: Identify environmental variables that differ between settings

  • Physiological state: Consider differences in bacterial physiological state between culture and environmental conditions

  • Substrate availability: Evaluate differences in substrate concentration and accessibility

  • Competitive interactions: Assess the influence of microbial community interactions

  • Methodological limitations: Examine differences in detection sensitivity between methods

These discrepancies often provide valuable insights into ecological context and regulation of YedZ activity. Studies with other recombinant Pseudomonas strains have shown that in vitro and in situ antibiotic production can differ significantly, with some recombinant strains producing up to 11-fold more compound in the rhizosphere than the parent strain .

What are promising avenues for engineering YedZ for enhanced catalytic efficiency or substrate specificity?

Future engineering approaches for YedZ improvement include:

  • Structure-guided mutagenesis: Targeted modifications based on structural insights

  • Directed evolution: Random mutagenesis followed by screening for improved variants

  • Domain swapping: Creating chimeric proteins with domains from related enzymes

  • Co-factor modification: Engineering proteins to accommodate modified heme groups

  • Computational design: Using in silico approaches to predict beneficial mutations

Progress in these areas requires combining biochemical characterization with structural biology and computational approaches. Success should be quantified through comparative kinetic analysis of wild-type and engineered variants.

How might systems biology approaches advance our understanding of YedZ in cellular redox networks?

Systems biology offers several approaches to contextualize YedZ function:

  • Metabolic modeling: Incorporating YedZ into genome-scale metabolic models

  • Protein interaction networks: Mapping YedZ interactions within the cellular protein network

  • Transcriptional regulation: Analyzing the regulation of yedZ in response to environmental signals

  • Comparative genomics: Examining evolutionary patterns of yedZ across bacterial species

  • Multi-omics integration: Combining proteomics, transcriptomics, and metabolomics data

These approaches can reveal emergent properties not apparent from studying YedZ in isolation and identify potential applications for biotechnology and environmental science.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.