Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase 1 (uppP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP1; Pfl01_2602; Undecaprenyl-diphosphatase 1; Bacitracin resistance protein 1; Undecaprenyl pyrophosphate phosphatase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain Pf0-1)
Target Names
uppP1
Target Protein Sequence
MDLWTALQALILGVVEGLTEFLPISSTGHQIIVADLLDFGGERAMAFNIIIQLGAILAVV WEFRRKILDVVIGLPTQPSARRFTANLLIAFLPAVVLGVIFADLIHHYLFNPITVAAALV VGGIVMLWAEQRQHEVHAETVDEIRWTDALKIGFAQCLAMIPGTSRSGSTIIGGLLFGLS RKTATEFSFFLAMPTMVGAAVYSGYKYRDLFVPADFPVFAIGFVTAFIFAMIAVRGLLKF IGSHSYAAFAWYRIVFGLVILATWQFGWVDWTAAQP
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Undecaprenyl-diphosphatase 1 (uppP1) in Pseudomonas fluorescens?

Undecaprenyl-diphosphatase 1 (uppP1) serves a critical function in bacterial cell wall biosynthesis. Similar to related enzymes characterized in other bacterial species, uppP1 likely catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, a key step in peptidoglycan recycling pathways. This recycling process is essential for maintaining bacterial cell wall integrity and facilitating continuous growth. The enzyme's activity represents a crucial checkpoint in cell wall synthesis, as improper functioning can lead to compromised cell envelope structure and potentially bacterial death.

Studies of homologous enzymes suggest that uppP1 functions within membrane-associated complexes that coordinate sequential steps in peptidoglycan assembly. This coordination ensures efficient utilization of cell wall precursors and energy resources, particularly during active growth phases. The enzyme's importance is underscored by the essentiality of related genes in bacterial species like Streptococcus pneumoniae, where disruption of undecaprenyl pathway genes proves lethal .

How does recombinant uppP1 activity differ from native enzyme activity?

Recombinant uppP1 activity may differ from native enzyme activity in several important aspects. Based on studies of analogous enzymes, recombinant versions often demonstrate comparable catalytic efficiency but can show differences in stability and cofactor requirements. For instance, studies with recombinant Upp synthetase from E. coli, H. influenzae, and S. pneumoniae revealed that while core enzymatic functions were preserved, specific biochemical characteristics varied across expression systems .

When working with recombinant uppP1, researchers should evaluate:

  • Substrate specificity profiles compared to native enzyme

  • Detergent dependency differences (similar to Triton X-100 requirements seen in Upp synthetase)

  • Alterations in metal ion dependencies (particularly Mg²⁺ requirements)

  • Thermostability profiles relative to the native enzyme

These differences likely stem from the recombinant protein lacking native membrane context or post-translational modifications present in P. fluorescens. Experimental designs must account for these potential variances when extrapolating biochemical findings to physiological contexts.

What are the critical variables to control when designing experiments with recombinant uppP1?

When designing experiments with recombinant uppP1, researchers must control multiple variables to ensure valid and reproducible results. Based on experimental design principles, researchers should consider the following internal validity threats:

First, instrumentation variation can significantly impact enzymatic assay results . Calibration drift in spectrophotometers or HPLC systems used to measure reaction products might be misinterpreted as changes in enzyme activity. Implement standard calibration protocols before each experimental session and include appropriate controls.

Second, statistical regression effects can confound results, particularly when selecting enzyme preparation batches based on extremely high activity values . Activity measurements naturally fluctuate, and selecting preparations solely based on highest activity may lead to regression toward mean values in subsequent experiments.

Third, experimental mortality (sample degradation) must be carefully monitored . Undecaprenyl-diphosphatase activity is likely membrane-dependent and sensitive to storage conditions. Establish consistent enzyme storage protocols and measure activity decay rates to normalize time-dependent variables.

Finally, interactions between experimental treatments should be considered when applying multiple conditions to the same enzyme preparation . Previous treatments may modify enzyme behavior in ways that persist through subsequent experiments, potentially confounding results from sequential testing paradigms.

How should researchers optimize expression and purification protocols for recombinant uppP1?

Optimizing expression and purification protocols for recombinant uppP1 requires systematic evaluation of multiple parameters. Drawing from approaches used with related bacterial enzymes, researchers should implement a multi-stage optimization strategy.

For expression optimization, consider testing:

  • Expression host strains (BL21(DE3), C41(DE3), or other specialized strains)

  • Induction conditions (IPTG concentration, temperature, duration)

  • Fusion tag configurations (N-terminal versus C-terminal His-tags)

  • Codon optimization for P. fluorescens sequences

The purification protocol should be optimized with attention to:

  • Detergent selection and concentration during membrane protein extraction

  • Affinity chromatography conditions (imidazole gradient profiles)

  • Additional purification steps (ion exchange, size exclusion)

  • Buffer composition effects on enzyme stability

What are the recommended methods for measuring uppP1 enzymatic activity?

Measuring uppP1 enzymatic activity requires specialized assays that account for the membrane-associated nature of the substrate and enzyme. Based on methodologies applied to related enzymes, researchers should consider implementing one or more of the following approaches:

A radiometric assay using radiolabeled substrates provides high sensitivity and specificity. This approach would involve incubating uppP1 with [³²P]-labeled undecaprenyl pyrophosphate and quantifying the released inorganic phosphate. Similar methodologies using tritium-labeled substrates have been successfully employed for related enzymes, as evidenced by the labeling of Upp synthetase with ([1-³H]-(2-diazo-3-trifluoropropionyloxy)geranyl diphosphate) .

Alternatively, a coupled enzyme assay system may be implemented. This would link uppP1 activity to a secondary reaction that produces a chromogenic or fluorogenic product. While this approach offers real-time monitoring capability, careful validation is required to ensure that the coupling enzyme does not become rate-limiting.

For all assay formats, researchers must empirically determine optimal conditions, including:

  • Detergent type and concentration (likely Triton X-100 dependent, as with Upp synthetase)

  • Metal ion requirements (typically Mg²⁺ dependent)

  • pH optimization

  • Temperature stability ranges

How can researchers accurately determine kinetic parameters for uppP1?

Accurate determination of kinetic parameters for uppP1 requires addressing several technical challenges unique to membrane-associated enzymes. Researchers should implement a systematic approach that accounts for potential confounding factors.

Initial velocity experiments should be conducted across a range of substrate concentrations (typically 0.1-10× Km) while maintaining excess substrate relative to enzyme. For uppP1, the hydrophobic nature of undecaprenyl pyrophosphate necessitates careful consideration of substrate presentation in mixed micelle systems.

The following kinetic parameters should be determined:

ParameterDescriptionTypical Determination Method
KmSubstrate concentration at half-maximal velocityLineweaver-Burk or non-linear regression analysis
VmaxMaximum reaction velocityExtrapolation to infinite substrate concentration
kcatCatalytic constant (turnover number)Vmax/[E]t calculation
kcat/KmCatalytic efficiencyRatio calculation or competition experiments

When analyzing kinetic data, researchers should be aware of potential artifact sources:

  • Substrate depletion in membrane environments

  • Product inhibition effects

  • Detergent interference with substrate availability

  • Time-dependent enzyme inactivation

For comparative analysis, results should be normalized to a reference standard, potentially using purified uppP1 prepared following standardized protocols similar to those used for related enzymes .

What techniques are most effective for elucidating uppP1 structure-function relationships?

Elucidating uppP1 structure-function relationships requires a multi-technique approach that addresses both structural features and their correlation with enzymatic activity. Researchers should implement complementary methodologies that provide insights at different resolution levels.

Site-directed mutagenesis represents a powerful approach for identifying catalytically important residues. Based on sequence homology with related enzymes, conserved motifs likely to be involved in substrate binding or catalysis should be targeted. Each mutant should undergo full kinetic characterization to quantify effects on catalytic parameters. This approach proved valuable in characterizing the functional domains of related enzymes like Upp synthetase .

For structural analysis, researchers might employ:

  • X-ray crystallography (challenging for membrane proteins but potentially feasible with appropriate detergent or lipid cubic phase approaches)

  • Cryo-electron microscopy (particularly suitable for membrane protein complexes)

  • Hydrogen-deuterium exchange mass spectrometry (to identify dynamic regions and substrate interaction sites)

  • Molecular dynamics simulations (to model membrane integration and substrate docking)

Complementary biochemical approaches should include:

  • Chemical modification of specific residue types

  • Substrate protection assays

  • Crosslinking studies with substrate analogs

  • Limited proteolysis to identify domain boundaries

The integration of these approaches will yield a comprehensive understanding of structure-function relationships in uppP1, potentially revealing mechanistic insights relevant to broad classes of membrane-associated phosphatases.

How can researchers effectively use uppP1 as a target for inhibitor development?

Using uppP1 as a target for inhibitor development requires a strategic approach that addresses both the biochemical properties of the enzyme and its physiological context. Researchers pursuing this direction should implement a staged screening and validation pipeline.

Initial screening approaches might include:

  • High-throughput biochemical assays using purified recombinant uppP1

  • In silico docking studies based on homology models or experimentally determined structures

  • Fragment-based screening to identify chemical scaffolds with binding potential

  • Repurposing screens using approved drugs or clinical candidates

For each identified hit, researchers should characterize:

  • Inhibition mechanisms (competitive, non-competitive, uncompetitive)

  • Structure-activity relationships

  • Selectivity profiles against human phosphatases

  • Physicochemical properties relevant to membrane penetration

The most promising candidates should undergo cellular validation using engineered P. fluorescens strains with modulated uppP1 expression. Similar approaches have proven valuable in other bacterial systems, as demonstrated by the essential nature of related enzymes for bacterial growth .

When interpreting inhibitor efficacy data, researchers should consider potential confounding factors such as membrane permeability barriers, efflux pump activity, and off-target effects on other cellular processes. Combination studies with established cell wall targeting antibiotics may provide insights into potential synergistic interactions.

What methodological approaches can resolve contradictory findings in uppP1 research?

Resolving contradictory findings in uppP1 research requires rigorous methodological approaches that address potential sources of experimental variability. Researchers should systematically evaluate factors that might contribute to divergent results.

First, examine differences in experimental design that might explain contradictory outcomes . Consider whether variables such as enzyme source, purification methods, assay conditions, or analytical techniques differ between studies. Standardization of key protocols across research groups can facilitate more direct comparisons.

Second, implement factorial experimental designs to systematically evaluate interaction effects between variables . This approach can reveal whether contradictory findings stem from complex interactions between experimental parameters rather than fundamental disagreements about enzyme properties.

Third, conduct replication studies with attention to statistical power considerations . Ensure sample sizes are sufficient to detect relevant effect sizes, and implement appropriate statistical analyses to quantify confidence in observed differences.

Finally, consider external validity factors that might limit generalizability across experimental systems . For instance, findings obtained with recombinant uppP1 in artificial membrane systems might not translate directly to native enzyme behavior in bacterial membranes.

By addressing these methodological considerations, researchers can develop a more coherent understanding of uppP1 biochemistry and resolve apparent contradictions in the literature.

What are common pitfalls in uppP1 expression and purification, and how can they be addressed?

Expression and purification of recombinant uppP1 present several technical challenges common to membrane-associated enzymes. Researchers frequently encounter specific pitfalls that can be addressed through systematic troubleshooting.

Low expression yields often result from toxicity of the overexpressed membrane protein. This can be addressed by:

  • Using tightly regulated expression systems with minimal leaky expression

  • Lowering induction temperature (16-20°C)

  • Reducing inducer concentration

  • Testing specialized expression hosts designed for toxic proteins

For protein aggregation issues:

  • Optimize detergent selection and concentration during extraction

  • Include glycerol (5-10%) in purification buffers

  • Evaluate different solubilization strategies (including systematic detergent screens)

  • Consider fusion partners that enhance solubility

Activity loss during purification might stem from:

  • Cofactor depletion (particularly divalent cations like Mg²⁺, shown to be critical for related enzymes)

  • Oxidation of catalytic cysteine residues

  • Detergent-induced conformational changes

  • Removal of stabilizing lipids

These issues can be systematically addressed through buffer optimization, inclusion of reducing agents, and careful selection of purification conditions based on activity measurements at each stage.

How should researchers interpret unexpected results in uppP1 functional studies?

Interpreting unexpected results in uppP1 functional studies requires a systematic evaluation of both biological and technical factors that might explain the observations. Researchers should consider multiple explanatory hypotheses before concluding that results contradict established understanding.

For activity discrepancies between experiments:

  • Evaluate enzyme stability under storage conditions

  • Verify substrate quality and purity

  • Assess potential contaminating phosphatase activities

  • Examine assay component interactions

When comparing results to published literature:

  • Consider differences in recombinant construct design (tag position, linker sequences)

  • Evaluate species-specific differences in enzyme properties

  • Assess whether experimental conditions match previously reported parameters

  • Examine methodology differences that might affect results interpretation

For unexpected inhibitor responses:

  • Investigate potential aggregation-based inhibition artifacts

  • Evaluate compound stability under assay conditions

  • Consider off-target effects on assay components

  • Examine potential binding to substrate rather than enzyme

As shown in studies with analogous enzymes, even well-characterized proteins can exhibit unexpected behaviors when experimental conditions are modified . Thorough documentation of all experimental parameters facilitates proper interpretation of such results.

Suggested Questions for Further Research:

  • What is the evolutionary relationship between uppP1 and related phosphatases across bacterial species?

  • How does membrane composition affect uppP1 activity and localization?

  • What role does uppP1 play in bacterial stress responses and antibiotic resistance mechanisms?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.