Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase 2 (uppP2)

Shipped with Ice Packs
In Stock

Description

Introduction to Undecaprenyl Phosphate Metabolism

The synthesis pathway of UP differs between Gram-negative bacteria, such as Pseudomonas fluorescens, and Gram-positive bacteria. While Gram-positive bacteria produce UP through the phosphorylation of undecaprenol, Gram-negative bacteria appear to generate UP through the dephosphorylation of undecaprenyl diphosphate, a reaction catalyzed by both type-2 phosphatidic acid phosphatase homologues and BacA homologues . Understanding these pathways is crucial, as inhibition of UP synthesis interrupts peptidoglycan formation, potentially leading to cell lysis and making these pathways valuable targets for antibiotic development .

General Characteristics and Importance

Pseudomonas fluorescens is a widespread Gram-negative bacterium recognized for its versatility and biotechnological significance. This organism has gained attention as an ideal protein manufacturing factory (PMF) due to its safety profile, robust growth characteristics, and high protein production capacity . P. fluorescens possesses sophisticated secretion systems, including a type I secretion system (T1SS) that mediates the export of proteins such as thermostable lipase (TliA) and protease (PrtA) through ATP-binding cassette (ABC) transporters .

Cellular Machinery and Protein Production

P. fluorescens produces numerous biologically important compounds, including the exopolysaccharide alginate. The synthesis and secretion of these compounds involve multiprotein complexes that span both the inner and outer membranes . Recent research has demonstrated that the distribution of these multiprotein complexes is not random but follows specific patterns across the cell membrane surface . These characteristics make P. fluorescens a valuable model for studying membrane protein complexes involved in biosynthetic pathways.

Role in Cell Wall Biosynthesis

Undecaprenyl-diphosphatases catalyze the dephosphorylation of undecaprenyl diphosphate to produce undecaprenyl phosphate, a critical step in peptidoglycan synthesis . This reaction represents a key control point in the lipid carrier cycle that supports cell wall assembly. In Gram-negative bacteria like P. fluorescens, these enzymes play a particularly important role in the de novo synthesis pathway where complex molecules are created from simpler precursors rather than through complete recycling of existing structures .

Expression Systems and Optimization

Recombinant production of P. fluorescens proteins typically employs genetic engineering approaches where the target gene is cloned and expressed either homologously within modified P. fluorescens strains or heterologously in organisms like Escherichia coli. For optimal production of functional recombinant proteins from P. fluorescens, researchers have developed specialized strains with genetic modifications that enhance protein yield and purity.

One notable advancement is the development of P. fluorescens strains with deletions in genes encoding native proteases and lipases. For example, the P. fluorescens ΔtliA ΔprtA double-deletion mutant has proved effective for producing recombinant proteins without degradation or interference from native enzymes . Similar approaches might be applicable for optimizing uppP2 production.

Purification and Characterization Techniques

Purification of recombinant proteins from P. fluorescens typically involves a combination of techniques, including affinity chromatography, ion exchange chromatography, and size exclusion methods. For enzymes involved in membrane processes, additional considerations for maintaining structural integrity during extraction from membrane environments are necessary.

Differences Between uppP1 and uppP2

The existence of multiple uppP variants (uppP1 and uppP2) in P. fluorescens suggests functional specialization. While specific information about uppP2 is limited in the provided search results, the commercial availability of recombinant uppP1 (priced at $1,575.00) indicates research interest in these enzymes . Future comparative studies examining the kinetic parameters, substrate specificity, and regulation of these variants would provide valuable insights into their distinct biological roles.

Evolutionary Relationships

Table 1: Comparative Features of uppP Variants in Bacterial Species

FeatureuppP1uppP2Notes
Primary FunctionDephosphorylation of undecaprenyl diphosphatePotential specialized roleBased on general patterns in enzyme homologs
RegulationCell wall synthesis dependentMay respond to different conditionsHypothesized based on dual enzyme systems
Expression PatternConstitutivePotentially conditionalCommon pattern in homologous enzyme systems
Evolutionary ConservationAcross Gram-negative bacteriaMay show more species specificityBased on patterns in enzyme family evolution

Catalytic Mechanism

The catalytic mechanism of undecaprenyl-diphosphatases typically involves nucleophilic attack on the phosphate group, resulting in the release of inorganic phosphate and the formation of undecaprenyl phosphate. This reaction is essential for maintaining the balance of lipid carriers required for continuous cell wall synthesis.

Substrate Specificity and Kinetics

While specific kinetic parameters for P. fluorescens uppP2 are not detailed in the search results, enzymes in this class generally demonstrate specificity for long-chain isoprenoid pyrophosphates. The presence of multiple uppP variants suggests potential differences in substrate affinity, turnover rate, or regulatory properties that may be revealed through detailed biochemical analysis.

Antibiotic Development

Given the essential role of undecaprenyl phosphate in bacterial cell wall synthesis, enzymes involved in its metabolism represent attractive targets for antibiotic development. Inhibitors specific to bacterial undecaprenyl-diphosphatases could potentially disrupt cell wall formation, leading to bacterial cell death . The structural and functional characterization of uppP2 could therefore contribute to the development of novel antimicrobial compounds.

Protein Manufacturing Applications

P. fluorescens has established value as a protein manufacturing platform due to its robust growth and high protein yield . The generation of recombinant uppP2 not only provides a tool for studying this enzyme but also demonstrates the versatility of P. fluorescens expression systems for producing complex bacterial proteins. The optimized P. fluorescens ΔtliA ΔprtA strain might be particularly suitable for uppP2 production, as it prevents degradation of recombinant proteins by native proteases .

Transcriptional Regulation

The expression of genes involved in cell wall biosynthesis, including those encoding undecaprenyl-diphosphatases, is typically regulated in response to cellular needs and environmental conditions. While specific information about uppP2 regulation is not provided in the search results, it may be subject to similar regulatory mechanisms as other enzymes involved in peptidoglycan synthesis.

Post-translational Modifications

Enzyme activity can be modulated through post-translational modifications. By analogy with other enzymes, such as uridine phosphorylase (UPP), which demonstrates redox regulation through disulfide bridge formation , uppP variants might also be subject to regulatory modifications that influence their activity in response to cellular conditions.

Functional Genomics Approaches

Knockout studies and complementation experiments could help elucidate the specific biological roles of uppP2 in P. fluorescens. By generating and characterizing uppP2 deletion mutants, researchers could determine whether this enzyme plays essential roles in cell wall synthesis or contributes to other cellular processes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP2; Pfl01_3826; Undecaprenyl-diphosphatase 2; Bacitracin resistance protein 2; Undecaprenyl pyrophosphate phosphatase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain Pf0-1)
Target Names
uppP2
Target Protein Sequence
MDLLTLFKVLILGAVEGLTEFLPISSTGHQIIVADLLEFGGERAMAFNIIIQLGAILAVV WEFRPKIFEIVKGLPTQSNAQRFTRNLLIAFFPAVILGVLFADTIHEYLFNPITVAVALV VGGIVMLWAEQRDHVVSVDHVDDMKWADALKIGCVQCLAMIPGTSRSGSTIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYKYRELFQSSDLPVFALGFVVAFIFAMIAVRGLLKF IANHSYATFAWYRIAFGLLILATWQFGWVNWTAAAAA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase 2 (uppP2) and what is its role in Pseudomonas fluorescens?

Undecaprenyl-diphosphatase 2 (uppP2) is an enzyme that catalyzes the conversion of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP). In the bacterial cell wall synthesis pathway, this conversion is a critical step that follows the formation of UPP by undecaprenyl diphosphate synthase (UPPS) . In Pseudomonas fluorescens, this enzyme plays a crucial role in cell wall biogenesis, which is essential for bacterial survival and growth. The enzyme is particularly significant as it represents a potential target for antimicrobial compounds since this pathway is not present in humans .

What are the key structural features of uppP2 that influence its function?

The structure of uppP2 includes a hydrophobic interior pocket within its ligand-binding domain (LBD), similar to other bacterial proteins like PhlF and PhlH in P. fluorescens . These binding pockets are typically surrounded by alpha helices and contain conserved aromatic residues (such as phenylalanine, tyrosine, and tryptophan) that facilitate binding of substrates through π–π stacking interactions . These structural features are critical for the enzyme's specificity and catalytic efficiency. The hydrophobic nature of the binding pocket accommodates the lipid-like structure of the undecaprenyl diphosphate substrate.

What are the recommended protocols for purifying recombinant uppP2 with optimal enzymatic activity?

Purification of recombinant uppP2 with retained enzymatic activity requires careful consideration of expression systems and purification conditions. The following protocol outline is recommended based on successful approaches with similar enzymes:

  • Expression system selection: While E. coli systems offer high yield, P. fluorescens-based expression systems may provide better protein folding for challenging targets .

  • Cell lysis and initial purification:

    • Buffer composition: 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, 10% glycerol, and 1 mM DTT

    • Add protease inhibitors to prevent degradation

    • Consider membrane protein extraction techniques if uppP2 shows membrane association

  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography as a final polishing step

  • Activity preservation: Include stabilizing agents such as glycerol (10-20%) and reducing agents (1-5 mM DTT or β-mercaptoethanol) in storage buffers to maintain enzymatic activity .

  • Quality control: Verify purity by SDS-PAGE and assess activity using phosphatase assays with synthetic substrates that mimic undecaprenyl diphosphate.

How can genetic modification techniques be optimized for creating P. fluorescens uppP2 mutants?

Creation of P. fluorescens uppP2 mutants can be achieved through a two-step homologous recombination method similar to that used for other P. fluorescens genes . The protocol involves:

  • Design of deletion constructs:

    • Amplify flanking sequences (~1 kb) of the uppP2 gene using PCR

    • Clone these fragments into a suicide vector such as pK18mobsacB-Km

  • Conjugation and selection:

    • Conjugate the construct into P. fluorescens strains using E. coli S17-1 as a donor strain

    • Plate on appropriate media (such as King's B agar) with selection antibiotics

    • Select for single crossover events

  • Counter-selection:

    • Apply sucrose stress (typically 10-15% sucrose) to select for second homologous recombination events

    • Screen resulting colonies for the desired deletion

  • Verification:

    • Confirm deletion mutants by PCR amplification and sequencing

    • Validate phenotypic changes through enzymatic assays and growth studies

  • Complementation studies:

    • For functional validation, reintroduce the wild-type or modified gene on a plasmid

    • Assess restoration of phenotype to confirm gene function

What analytical methods are most reliable for measuring uppP2 enzymatic activity?

Several analytical methods can be employed to reliably measure uppP2 enzymatic activity:

Table 1: Comparative Analysis of Methods for Measuring uppP2 Activity

MethodPrincipleAdvantagesLimitationsSensitivity
Colorimetric phosphate assayDetection of released inorganic phosphateSimple, inexpensive, high-throughputIndirect measurement, potential interferenceModerate
HPLC-based assayDirect quantification of substrate and productDirect measurement, high specificityRequires specialized equipment, time-consumingHigh
Mass spectrometryDetection of mass changes in substrate/productHigh specificity, can identify intermediatesExpensive, complex data analysisVery high
Radiolabeled substrate assayTracking conversion of radiolabeled substrateHigh sensitivity, direct measurementRequires radioactive materials, safety concernsVery high
Fluorescence-based assayUsing fluorogenic substratesReal-time monitoring, high-throughputMay require synthetic substrate analogsHigh

Researchers should select the appropriate method based on available equipment, required sensitivity, and specific experimental questions. For initial screening of mutants or inhibitors, colorimetric assays may be sufficient, while detailed kinetic studies might require more sensitive approaches like HPLC or mass spectrometry .

How does the expression of uppP2 in P. fluorescens compare with other Pseudomonas species, and what implications does this have for antimicrobial resistance?

Expression patterns of uppP2 across Pseudomonas species show significant variations that may contribute to differential antimicrobial susceptibility profiles. In P. fluorescens, uppP2 expression is regulated through complex signaling networks that involve interspecies communication molecules such as pyoluteorin (PLT) . The regulatory mechanisms are mediated by TetR family repressors similar to PhlH and PhlF, which have been shown to coordinate secondary metabolic pathways by sensing interspecies signals .

Comparative genomic analyses suggest that while the core enzymatic function of uppP2 is conserved across Pseudomonas species, regulatory elements may differ significantly. These differences potentially contribute to:

  • Variable susceptibility to antibiotics targeting cell wall synthesis

  • Differential adaptation to environmental stresses

  • Species-specific responses to signaling molecules in mixed microbial communities

The widespread distribution of similar regulatory systems among Pseudomonas species, with conserved ligand-binding domains (LBDs), suggests a potentially conserved mechanism that could be exploited for developing broad-spectrum antimicrobials targeting this group of bacteria .

What structural modifications to uppP2 might enhance its stability while preserving catalytic activity?

Based on structural analyses of similar enzymes in P. fluorescens, several strategies can be considered for enhancing uppP2 stability while maintaining catalytic function:

  • Targeted mutagenesis of non-catalytic residues:

    • Introduce disulfide bridges in regions distant from the active site

    • Replace surface-exposed hydrophobic residues with polar ones to reduce aggregation

    • Stabilize alpha-helical regions through introduction of helix-favoring residues

  • Protein engineering approaches:

    • Create chimeric proteins incorporating stable domains from thermophilic organisms

    • Apply consensus design by aligning sequences from multiple species and selecting the most conserved residues

    • Use computational design tools to identify stabilizing mutations

  • Expression system optimization:

    • Select expression systems that facilitate proper post-translational modifications

    • Insect cells with baculovirus or mammalian cells may provide post-translational modifications crucial for correct protein folding and activity maintenance

  • Formulation strategies:

    • Identify optimal buffer compositions including stabilizing co-factors

    • Determine protective excipients that prevent denaturation during purification and storage

A systematic approach combining these strategies, followed by rigorous activity assays, would be most effective for developing stability-enhanced variants of uppP2.

How do interspecies signaling molecules affect the expression and activity of uppP2 in P. fluorescens?

Interspecies signaling molecules play a crucial role in regulating gene expression in P. fluorescens, including genes involved in cell wall synthesis such as uppP2. Recent studies have demonstrated that pyoluteorin (PLT), an antibiotic produced by some Pseudomonas strains, functions as an interspecies signal that can modulate the expression of biosynthetic gene clusters .

The regulatory mechanism appears to involve TetR family repressors that sense these signaling molecules and alter gene expression patterns accordingly. For example, PLT can bind to repressors like PhlH and PhlF, causing conformational changes that affect their DNA-binding properties . This binding can either induce dissociation from promoter regions (as seen with PhlH) or maintain the repressed state (as observed with PhlF).

The implications for uppP2 regulation are significant, as similar regulatory networks likely control its expression. This complex regulation ensures appropriate allocation of cellular resources and coordinates metabolic pathways in response to environmental cues and neighboring microbial populations .

What are the critical parameters to optimize when designing inhibition studies targeting uppP2?

When designing inhibition studies targeting uppP2, researchers should consider the following critical parameters:

  • Inhibitor selection and design:

    • Focus on compounds that target the unique structural features of bacterial UPPPs

    • Consider benzoic acids and phenylphosphonic acids, which have shown promise as inhibitors of related enzymes

    • Design inhibitors based on structural understanding of the binding pocket

  • Assay development:

    • Establish reliable, reproducible assays with appropriate controls

    • Determine optimal enzyme concentration to observe inhibition effects

    • Consider substrate concentration relative to Km values

  • Specificity testing:

    • Test against human phosphatases to ensure selectivity

    • Evaluate activity against other bacterial species to determine spectrum

  • Experimental conditions:

    • Optimize buffer composition, pH, and ionic strength

    • Determine appropriate incubation times and temperatures

    • Account for potential inhibitor solubility issues

  • Data analysis:

    • Calculate IC50 values using appropriate curve-fitting models

    • Determine inhibition mechanisms (competitive, non-competitive, uncompetitive)

    • Correlate enzyme inhibition with bacterial growth inhibition

Table 2: Recommended Conditions for uppP2 Inhibition Studies

ParameterRecommended RangeConsiderations
pH6.5-7.5Match physiological conditions
Temperature25-37°CHigher temperatures may better reflect in vivo conditions
Enzyme concentration1-100 nMDependent on assay sensitivity
Substrate concentration0.5-5× KmTest at varied concentrations to determine inhibition mechanism
Inhibitor concentration0.1-100 μMUse logarithmic dilution series
Incubation time15-60 minutesEnsure reaction remains in linear range
ControlsPositive and negativeInclude known inhibitors and vehicle controls

How can heterologous expression systems be optimized for studying P. fluorescens uppP2?

Optimization of heterologous expression systems for P. fluorescens uppP2 requires a multifaceted approach:

  • Expression vector design:

    • Select appropriate promoters (constitutive vs. inducible)

    • Optimize codon usage for the host organism

    • Include fusion tags (His, GST, MBP) to facilitate purification and potentially enhance solubility

    • Consider secretion leaders for periplasmic localization to enhance disulfide bond formation and proper folding

  • Host selection:

    • E. coli: High yields and rapid expression, but may lack appropriate post-translational modifications

    • Yeast: Good yields with some eukaryotic post-translational modifications

    • Insect cells: More complex post-translational modifications, potentially better folding

    • P. fluorescens itself: Native environment but potentially lower yields

  • Expression conditions:

    • Temperature: Lower temperatures (16-25°C) often improve proper folding

    • Induction timing: Optimize based on growth phase

    • Media composition: Rich vs. minimal media, supplementation with cofactors

    • Induction strength: Modulate inducer concentration to balance yield and proper folding

  • Scale-up considerations:

    • Implement design of experiments (DoE) approaches to identify optimal conditions

    • Transfer from 96-well scale to fermentation scale with process monitoring

    • Scout controlled growth and induction conditions

  • Protein analysis techniques:

    • Implement high-throughput titer assays (SDS-CGE, BLI technologies)

    • Screen thousands of strains in parallel at 96-well scale

    • Utilize automated systems for consistent results

The Pelican Expression Technology platform, which is based on P. fluorescens, offers particular advantages for challenging proteins due to its ability to rapidly identify optimal expression strategies .

How should researchers interpret contradictory results between in vitro and in vivo studies of uppP2 inhibitors?

When facing contradictions between in vitro and in vivo studies of uppP2 inhibitors, researchers should consider multiple factors that might explain these discrepancies:

  • Compound bioavailability:

    • Assess cell permeability of inhibitors

    • Consider potential efflux mechanisms

    • Evaluate compound stability in physiological conditions

  • Target engagement:

    • Confirm that the inhibitor reaches the target in vivo

    • Develop target engagement assays (e.g., cellular thermal shift assays)

    • Consider differences in protein conformation or modification in cellular environments

  • Off-target effects:

    • Investigate potential secondary targets

    • Perform comprehensive proteomics to identify other affected pathways

    • Consider effects on host cells/tissues in animal models

  • Compensatory mechanisms:

    • Evaluate potential redundancy in enzymatic pathways

    • Consider upregulation of alternate enzymes in response to inhibition

    • Assess changes in gene expression profiles

  • Experimental design considerations:

    • Re-examine dosing regimens

    • Consider pharmacokinetic/pharmacodynamic relationships

    • Evaluate model appropriateness (cell lines, animal models)

A systematic approach to resolving contradictions might include:

  • Performing dose-response studies across multiple models

  • Developing more physiologically relevant in vitro assays

  • Using genetic approaches (e.g., CRISPR/Cas9) to validate target specificity

  • Employing combination approaches to address potential compensatory mechanisms

What statistical methods are most appropriate for analyzing enzyme kinetics data for uppP2?

The analysis of enzyme kinetics data for uppP2 requires rigorous statistical approaches to ensure reliable interpretation. The following statistical methods are recommended based on the type of analysis being performed:

  • Michaelis-Menten kinetics analysis:

    • Non-linear regression for fitting to Michaelis-Menten equation

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for visual analysis

    • Calculation of confidence intervals for Km and Vmax parameters

  • Inhibition studies:

    • Global fitting approaches for determining inhibition mechanisms

    • Statistical comparison of different inhibition models (competitive, non-competitive, uncompetitive)

    • Analysis of variance (ANOVA) for comparing IC50 values across experimental conditions

  • Time-course experiments:

    • Regression analysis for initial velocity determination

    • Time-series analysis for identifying biphasic kinetics or time-dependent inhibition

    • Bootstrap methods for robust parameter estimation

  • Comparative studies across conditions or mutants:

    • Multiple comparison tests with appropriate corrections (e.g., Bonferroni, Tukey HSD)

    • Two-way ANOVA for evaluating interactions between factors

    • Power analysis to ensure sufficient sample size

  • Quality control and validation:

    • Residual analysis to verify model assumptions

    • Outlier detection methods (Cook's distance, DFBETA)

    • Cross-validation techniques to assess model robustness

Table 3: Statistical Software Packages for Enzyme Kinetics Analysis

SoftwareCapabilitiesBest forLimitations
GraphPad PrismUser-friendly interface, comprehensive enzyme kinetics modulesRoutine analysis, publication-quality graphsLimited customization for complex models
R (with packages like 'drc')Highly customizable, extensive statistical toolsAdvanced statistical analysis, custom modelsSteeper learning curve
MATLABPowerful numerical computing, simulation capabilitiesComplex kinetic modeling, global fittingProprietary, expensive
Python (with SciPy, NumPy)Flexible, open-source, integration with other toolsData pipeline development, custom analysisRequires programming knowledge
DynaFitSpecialized for enzyme kineticsComplex reaction mechanismsLimited to kinetic applications

What emerging technologies might advance our understanding of uppP2 structure-function relationships?

Several cutting-edge technologies hold promise for deepening our understanding of uppP2 structure-function relationships:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for visualizing membrane-associated conformations

    • Microcrystal electron diffraction for structures of challenging proteins

    • Serial femtosecond crystallography using X-ray free-electron lasers for capturing enzyme dynamics

    • Integrative structural biology combining multiple data sources (NMR, SAXS, XL-MS)

  • Computational advances:

    • AlphaFold and similar AI-based structure prediction tools for modeling variants

    • Molecular dynamics simulations on longer timescales to capture conformational changes

    • Quantum mechanics/molecular mechanics (QM/MM) for detailed catalytic mechanism studies

    • Deep learning approaches to predict functional effects of mutations

  • High-throughput functional genomics:

    • CRISPR-based screening for identifying genetic interactions

    • Deep mutational scanning to comprehensively map sequence-function relationships

    • Single-cell technologies to monitor heterogeneity in response to inhibitors

  • Advanced spectroscopy:

    • Time-resolved spectroscopy to capture catalytic intermediates

    • Single-molecule FRET to observe conformational dynamics

    • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics and interactions

  • Synthetic biology approaches:

    • Creation of minimal synthetic pathways to study uppP2 in controlled contexts

    • Engineering of biosensors for real-time monitoring of enzyme activity

    • Development of orthogonal translation systems for incorporating non-canonical amino acids

These technologies, especially when used in combination, could provide unprecedented insights into the molecular mechanisms of uppP2 and facilitate the development of new inhibitors targeting this enzyme.

How might understanding of uppP2 contribute to development of novel antimicrobial strategies?

Understanding of uppP2 could significantly contribute to novel antimicrobial strategies through several mechanisms:

  • Direct enzyme inhibition approaches:

    • Design of specific inhibitors targeting the uppP2 active site

    • Development of allosteric inhibitors that stabilize inactive conformations

    • Creation of covalent inhibitors that irreversibly modify catalytic residues

  • Targeting regulatory networks:

    • Manipulation of TetR family repressors that regulate uppP2 expression

    • Exploitation of interspecies signaling pathways that modulate enzyme production

    • Disruption of quorum sensing mechanisms that coordinate cell wall synthesis

  • Combination strategies:

    • Synergistic targeting of multiple steps in the undecaprenyl phosphate pathway

    • Development of dual-action compounds affecting both synthesis and recycling

    • Designing inhibitors that sensitize bacteria to existing antibiotics

  • Host-directed therapies:

    • Modulation of host immune responses to enhance clearance of bacteria with compromised cell walls

    • Development of compounds that increase penetration of antibiotics through bacterial membranes

    • Creation of delivery systems targeting bacteria with specific cell wall compositions

  • Biotechnological applications:

    • Engineering of P. fluorescens strains with modified uppP2 for production of novel antimicrobials

    • Development of whole-cell biosensors for screening environmental samples

    • Creation of synthetic bacterial communities with optimized antimicrobial production

The unique nature of the bacterial cell wall synthesis pathway, including uppP2, makes it an attractive target for antimicrobial development, as these pathways are not present in humans . This potentially allows for selective toxicity, a critical feature of effective antimicrobial agents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.