Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP)

What is Undecaprenyl-diphosphatase (uppP) and what is its role in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase (uppP) catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to generate undecaprenyl phosphate (Und-P), which serves as the essential lipid carrier for peptidoglycan precursors across the cytoplasmic membrane during cell wall biosynthesis . In Pseudomonas fluorescens, uppP (also known as bacitracin resistance protein) is encoded by the gene uppP (locus name PFL_3114) and belongs to the EC 3.6.1.27 classification .

The enzyme plays a critical role in recycling the lipid carrier molecule, as Und-P is essential for the synthesis of peptidoglycan and wall teichoic acids . Studies in related bacteria like Bacillus subtilis have demonstrated that UPP phosphatases are essential for bacterial viability, with cells requiring at least one functional UPP phosphatase for survival . This underscores the enzyme's fundamental importance in bacterial physiology and its potential as an antimicrobial target.

What are the optimal storage and handling conditions for Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP)?

Proper storage and handling of Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) is critical for maintaining enzymatic activity. The recommended storage conditions include:

• Long-term storage: -20°C or -80°C for extended stability

• Working aliquots: 4°C for up to one week

• Storage buffer: Tris-based buffer containing 50% glycerol, specifically optimized for this protein

To maintain enzyme activity during experimental procedures:

• Avoid repeated freeze-thaw cycles as they significantly diminish enzyme activity

• Prepare small working aliquots to minimize the need for repeated thawing

• Use sterile technique to prevent contamination

• Keep the enzyme on ice during experiments

• Consider supplementing buffers with protease inhibitors to prevent degradation

Quality control measures should include:

• Periodic activity assays to verify enzyme functionality

• SDS-PAGE analysis to confirm protein integrity

• Optimization of protein concentration for specific experimental applications

What structural and functional characteristics define Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP)?

Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) is a membrane-associated enzyme with distinctive structural and functional properties:

Structural Features:

• Full protein length: 276 amino acids

• Contains multiple transmembrane domains, as indicated by the hydrophobic nature of its amino acid sequence

• The amino acid sequence (MDLWTAAQALILGIVEGLTEFLPISSTGHQIIVADLLDFGGERAMAFNIIIQLGAILAVVWEFRRKILDVVIGLPTQPKAQRFTINLLIAFLPAVVLGVIFADLIHAYLFNPITVATALLVGGLIMWAERRQHQVHAET VDDITWKDALKVGCAQCLAMIPGTSRSGSTIIGGLLFGLSRKTATEFSFFLAMPTMVGAAVYSGYKYRHLFQPDDFPVFAIGFVTAFVFAMIAVKGLLKFIASHSYAAFAWYRIAFGLLILATWQFGWVDWTAAKP) reveals functional domains typical of phosphatase enzymes

• Shares homology with other bacterial UPP phosphatases, particularly in catalytic regions

Functional Characteristics:

• Catalyzes the hydrolysis of undecaprenyl pyrophosphate to undecaprenyl phosphate

• Requires specific divalent cations (typically Mg²⁺ or Mn²⁺) for optimal activity

• Functions in the bacterial cell membrane, where its substrate is localized

• Confers resistance to bacitracin, an antibiotic that binds to undecaprenyl pyrophosphate

• Essential for peptidoglycan biosynthesis and bacterial cell wall integrity

The enzyme's association with bacterial membranes presents specific challenges for experimental work, requiring detergent-based approaches for extraction and purification while maintaining enzyme activity.

What experimental techniques can be used to study the enzymatic activity of Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP)?

Measuring the enzymatic activity of Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) requires specialized techniques that can detect the dephosphorylation of undecaprenyl pyrophosphate with high sensitivity and specificity. The following methodological approaches are commonly employed:

Spectrophotometric Assays:

• Malachite green assay: Quantifies released inorganic phosphate with colorimetric detection

• Continuous coupled enzyme assays: Links phosphate release to NADH oxidation (monitored at 340 nm)

• EnzChek Phosphate Assay: Uses enzymatic conversion of substrate to generate a measurable product

Radiometric Methods:

• [³²P]-labeled substrate tracking: Monitors the release of radiolabeled phosphate

• Thin-layer chromatography separation of substrate and product

• Scintillation counting for quantification

Chromatographic Approaches:

• HPLC separation with UV detection (typically at 210 nm)

• LC-MS/MS for sensitive and specific detection of substrates and products

• Ion chromatography for phosphate quantification

In Vivo Assessment:

• Complementation studies in bacterial strains lacking endogenous UPP phosphatase activity

• Antibiotic susceptibility testing (particularly with bacitracin)

• Phenotypic analysis of cell morphology using microscopy techniques

When designing activity assays, researchers should consider:

• Appropriate controls, including heat-inactivated enzyme

• The solubility challenges associated with the lipid substrate

• The influence of detergents on enzyme activity

• Optimization of reaction conditions (pH, temperature, ionic strength)

How should researchers design experiments to study the kinetics of Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP)?

Designing rigorous kinetic experiments for Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) requires careful consideration of the enzyme's membrane-associated nature and its lipid substrate. A comprehensive experimental design should include:

Initial Rate Determination:

• Measure initial velocities (v₀) at multiple substrate concentrations

• Ensure measurements occur within the linear portion of the reaction (<10% substrate conversion)

• Establish appropriate reaction times through preliminary time-course studies

• Use automated sampling methods when possible to improve precision

Substrate Concentration Series:

• Prepare a logarithmic series of substrate concentrations (typically spanning 0.2×Km to 5×Km)

• Include at least 7-8 concentration points for reliable curve fitting

• Address solubility issues of undecaprenyl pyrophosphate using appropriate detergents

• Maintain consistent detergent-to-substrate ratios across concentrations

Data Analysis:

• Plot initial velocity versus substrate concentration

• Fit data to appropriate models (Michaelis-Menten, Hill equation) using non-linear regression

• Calculate key parameters (Km, Vmax, kcat, kcat/Km) with confidence intervals

• Consider transformations (Lineweaver-Burk, Eadie-Hofstee) for visualization purposes only

Example Experimental Design Table:

Environmental Parameter Optimization:

• Systematically vary pH, temperature, ionic strength, and divalent cation concentration

• Generate activity profiles for each parameter

• Determine optimal conditions for maximum enzyme activity

• Consider using response surface methodology for multivariate optimization

Statistical Considerations:

• Include technical triplicates and biological replicates (minimum n=3)

• Randomize experiment order to minimize systematic errors

• Apply appropriate statistical tests to validate significance of observed differences

• Report all parameters with standard errors or confidence intervals

What approaches can be used to address the challenges in purifying active Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP)?

Purifying active Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) presents several challenges due to its membrane-associated nature. A systematic approach to address these challenges includes:

Expression System Optimization:

• Test multiple expression hosts:

  • E. coli strains specialized for membrane proteins (C41/C43)

  • Cell-free expression systems

  • P. fluorescens-based homologous expression

• Compare expression levels and activity between systems

• Optimize induction parameters (temperature, inducer concentration, duration)

Fusion Tag Selection:

• Screen different affinity tags (His₆, GST, MBP, SUMO)

• Test tag placement at N- or C-terminus

• Include precision protease cleavage sites for tag removal

• Consider dual tagging strategies for improved purity

Membrane Protein Extraction:

• Evaluate multiple detergents for extraction efficiency and activity preservation:

  • Mild detergents: DDM, LMNG

  • Zwitterionic detergents: CHAPS, FC-12

  • Newer amphipols or styrene maleic acid copolymers

• Optimize detergent concentration and extraction conditions

• Consider stepwise solubilization protocols

Purification Strategy:

• Implement multi-step chromatography:

  • Immobilized metal affinity chromatography (IMAC)

  • Ion exchange chromatography

  • Size exclusion chromatography

• Monitor protein purity and activity at each stage

• Calculate purification fold and recovery percentage

Example Purification Table:

Stability Enhancement:

• Optimize buffer composition systematically:

  • pH range (typically 6.5-8.0)

  • Salt type and concentration

  • Glycerol percentage (10-30%)

  • Reducing agents (DTT, TCEP)

• Add specific lipids that might be required for structural integrity

• Include protease inhibitors throughout purification

Quality Control:

• Verify protein identity by mass spectrometry

• Assess purity by SDS-PAGE (aim for >95%)

• Evaluate homogeneity by dynamic light scattering

• Confirm activity using standardized assays

How can researchers design experiments to investigate the role of Undecaprenyl-diphosphatase (uppP) in antibiotic resistance?

Investigating the role of Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) in antibiotic resistance requires a multifaceted experimental approach combining genetic, biochemical, and phenotypic analyses:

Genetic Manipulation Approaches:

• Generate uppP deletion or conditional knockdown strains using CRISPR-Cas9 or dCas9-based systems

• Create point mutations in catalytic residues to distinguish enzymatic from structural roles

• Construct complementation strains expressing wild-type or mutant versions of uppP

• Develop overexpression strains to assess the impact of increased uppP levels

Antibiotic Susceptibility Testing:

• Determine Minimum Inhibitory Concentrations (MICs) for a panel of antibiotics:

  • Cell wall synthesis inhibitors (β-lactams, bacitracin, vancomycin)

  • Membrane-targeting antibiotics (polymyxins)

  • Control antibiotics with different targets (fluoroquinolones, aminoglycosides)

• Perform time-kill kinetics to assess the rate of bacterial killing

• Measure post-antibiotic effects in wild-type versus mutant strains

Molecular Mechanism Investigations:

• Quantify peptidoglycan precursor accumulation using LC-MS

• Measure uppP enzyme activity in membrane preparations from resistant and sensitive strains

• Assess membrane integrity using fluorescent dyes

• Analyze peptidoglycan composition using HPLC

Resistance Development Studies:

• Conduct serial passage experiments with increasing antibiotic concentrations

• Compare resistance development rates in wild-type versus uppP-modified strains

• Sequence evolved strains to identify compensatory mutations

• Assess biofilm formation and antibiotic tolerance

Expression Analysis:

• Quantify uppP expression in response to antibiotic exposure using qRT-PCR

• Perform transcriptomic analysis to identify co-regulated genes

• Conduct proteomic studies to examine membrane protein changes

• Investigate regulatory pathways controlling uppP expression

Example Data Table:

These experimental approaches will provide comprehensive insights into how Undecaprenyl-diphosphatase (uppP) contributes to antibiotic resistance mechanisms in Pseudomonas fluorescens.

What methodologies can be employed to study the structure-function relationship of Undecaprenyl-diphosphatase (uppP)?

Elucidating the structure-function relationship of Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) requires integrated approaches combining structural biology, molecular biology, and biochemical techniques:

Structural Determination Methods:

• X-ray crystallography of purified uppP (challenging for membrane proteins)

• Cryo-electron microscopy for high-resolution structural analysis

• NMR spectroscopy for dynamic structural information

• Computational modeling and molecular dynamics simulations

• Homology modeling based on related UPP phosphatases with known structures

Site-Directed Mutagenesis Approaches:

• Identify conserved residues through sequence alignment with homologous enzymes

• Generate alanine-scanning mutants across predicted catalytic and substrate-binding regions

• Create chimeric proteins with domains from related phosphatases

• Design rational mutations based on computational predictions

Functional Characterization:

• Measure enzyme kinetics (Km, kcat, kcat/Km) for each mutant

• Determine substrate specificity profiles using substrate analogs

• Assess inhibitor sensitivity and binding parameters

• Compare thermal stability of wild-type and mutant proteins

Correlation Matrix Example:

Biophysical Interaction Studies:

• Surface plasmon resonance to measure binding kinetics

• Isothermal titration calorimetry for thermodynamic parameters

• Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

• Fluorescence spectroscopy to monitor conformational changes

In Vivo Validation:

• Complementation studies with mutant variants in uppP-deficient strains

• Assessment of cell morphology and growth characteristics

• Antibiotic susceptibility testing of strains expressing mutant variants

• Peptidoglycan compositional analysis

By combining these methodological approaches, researchers can establish detailed structure-function relationships for Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP), identifying critical residues involved in catalysis, substrate binding, and membrane interaction.

What statistical methods are appropriate for analyzing kinetic data for Undecaprenyl-diphosphatase (uppP)?

Analyzing kinetic data for Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) requires robust statistical approaches to ensure accurate parameter estimation and meaningful interpretation. The following methodological framework is recommended:

Data Preprocessing:

• Examine data for outliers using standardized residuals or Cook's distance

• Assess normality of residuals using Shapiro-Wilk or Kolmogorov-Smirnov tests

• Transform data if necessary to meet parametric test assumptions

• Implement weighted regression if variance is heteroscedastic (common with enzymatic data)

Non-linear Regression Approaches:

• Use direct non-linear regression rather than linearization methods (e.g., avoid Lineweaver-Burk for primary analysis)

• Apply appropriate enzyme kinetic models:

  • Michaelis-Menten for simple kinetics: v = (Vmax × [S])/(Km + [S])

  • Hill equation for cooperative binding: v = (Vmax × [S]^n)/(K' + [S]^n)

  • Competitive inhibition: v = (Vmax × [S])/(Km × (1 + [I]/Ki) + [S])

• Employ robust fitting algorithms (Levenberg-Marquardt or trust-region)

• Report R² values, standard errors, and confidence intervals for all parameters

Model Selection Criteria:

• Calculate Akaike Information Criterion (AIC) and Bayesian Information Criterion (BIC) values

• Perform F-tests for nested models to determine the simplest adequate model

• Conduct lack-of-fit tests to assess model appropriateness

• Examine residual plots for patterns indicating model inadequacy

Statistical Comparison of Parameters:

• Use extra sum-of-squares F-test to compare kinetic parameters between conditions

• Apply bootstrapping for non-parametric confidence interval estimation

• Employ analysis of variance (ANOVA) for multiple condition comparisons

• Implement Tukey's or Dunnett's post-hoc tests for pairwise comparisons

Example Statistical Analysis Workflow:

• Initial visual data inspection

• Compare models using statistical criteria:

  Model	R²	AIC	BIC	p-value (F-test)
  Michaelis-Menten	0.978	-42.3	-38.5	Reference
  Hill	0.985	-45.1	-39.4	0.035
  Substrate inhibition	0.986	-44.8	-38.9	0.041

• Select optimal model based on statistical criteria

• Extract and report parameters with confidence intervals

• Validate model with additional experiments

Reporting Guidelines:

• Present both raw data and fitted curves graphically

• Include residual plots to demonstrate goodness of fit

• Report all parameters with standard errors or confidence intervals

• Provide sufficient methodological detail for reproducibility

By implementing these statistical methods, researchers can obtain reliable kinetic parameters for Undecaprenyl-diphosphatase (uppP) and make valid comparisons between experimental conditions.

How can researchers reconcile conflicting data about the function of Undecaprenyl-diphosphatase (uppP) in different experimental contexts?

Reconciling conflicting data about Undecaprenyl-diphosphatase (uppP) function requires systematic analysis of methodological differences, biological variables, and experimental conditions. The following structured approach can help resolve such discrepancies:

Systematic Comparison Framework:

• Create a comprehensive comparison table documenting:

  • Experimental systems used (organism, strain, expression system)

  • Assay conditions (pH, temperature, buffer composition)

  • Protein preparation methods (tags, purification process)

  • Substrate source and preparation

  • Detection methods and sensitivity

• Identify key variables that differ between conflicting studies

Technical Validation Experiments:

• Reproduce critical experiments under standardized conditions

• Directly compare protein samples from different sources using identical assays

• Implement multiple orthogonal methods to measure the same parameter

• Develop robust positive and negative controls for activity assays

Biological Context Analysis:

• Evaluate the natural physiological context of each experimental system

• Consider the impact of genetic background on phenotypic outcomes

• Assess potential compensatory mechanisms in different organisms

• Examine the influence of growth conditions on gene expression and enzyme activity

Data Integration Strategies:

• Implement meta-analysis techniques to synthesize quantitative data across studies

• Use Bayesian approaches to update confidence in hypotheses based on all available evidence

• Develop mathematical models that can accommodate seemingly contradictory observations

• Consider that apparent conflicts may represent different aspects of a complex system

Example Reconciliation Table:

Communication and Documentation:

• Maintain transparent reporting of all experimental variables

• Document unexpected observations even if they conflict with hypotheses

• Engage with authors of conflicting studies to identify unrecognized variables

• Consider collaborative studies to directly address discrepancies

By systematically addressing the sources of conflicting data through this methodological framework, researchers can develop a more nuanced and accurate understanding of Undecaprenyl-diphosphatase (uppP) function across different experimental contexts.

What emerging techniques could advance our understanding of Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) function and regulation?

Several cutting-edge techniques hold promise for deepening our understanding of Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) function and regulation:

Advanced Structural Biology Approaches:

• Single-particle cryo-electron microscopy for high-resolution structures of membrane-embedded uppP

• Integrative structural biology combining multiple data sources (X-ray, NMR, crosslinking-MS)

• Time-resolved structural methods to capture enzyme conformational changes during catalysis

• In situ structural studies within native membrane environments

Genome Engineering Technologies:

• CRISPR-interference systems for precise transcriptional regulation

• Base editing for generating specific point mutations without double-strand breaks

• CRISPR-activation to study the effects of uppP overexpression

• Multiplexed genome editing to study interaction with other cell wall synthesis genes

Single-Cell Technologies:

• Single-cell RNA-seq to identify cell-to-cell variation in uppP expression

• Time-lapse microscopy with fluorescent reporters to monitor uppP expression dynamics

• Microfluidic platforms for analyzing single-cell responses to antibiotics

• Super-resolution microscopy to determine precise subcellular localization

Systems Biology Approaches:

• Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

• Genome-scale metabolic modeling to understand uppP's role in broader cellular networks

• Network analysis to identify regulatory relationships and pathway connections

• Synthetic biology approaches to reconstruct minimal cell wall synthesis systems

Emerging Biochemical Methods:

• Hydrogen-deuterium exchange mass spectrometry for studying protein dynamics

• Native mass spectrometry to analyze protein-lipid interactions

• Nanodiscs and styrene-maleic acid lipid particles (SMALPs) for studying membrane proteins

• Activity-based protein profiling to identify active enzyme populations

Example Research Application Matrix:

By applying these emerging techniques, researchers can address currently intractable questions about Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) structure, function, and regulation, potentially revealing new therapeutic opportunities targeting this essential enzyme.

How might research on Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) inform antibiotic development strategies?

Research on Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) has significant implications for antibiotic development, particularly given the pressing global challenge of antimicrobial resistance. Several strategic research directions could translate uppP knowledge into novel therapeutic approaches:

Target Validation Approaches:

• Genetic essentiality studies across diverse bacterial pathogens

• Chemical genetic screens to identify synthetic lethal interactions

• In vivo infection models with uppP-depleted strains

• Compensatory pathway mapping to predict resistance mechanisms

Structure-Based Drug Design:

• High-resolution structural determination of uppP from multiple bacterial species

• Computational mapping of druggable binding pockets

• Fragment-based screening against purified uppP

• Structure-activity relationship studies of identified inhibitors

Combination Therapy Strategies:

• Synergy screening between uppP inhibitors and existing antibiotics

• Identification of collateral sensitivity patterns

• Development of dual-target inhibitors affecting multiple steps in cell wall synthesis

• Sequential treatment protocols to minimize resistance development

Resistance Mechanism Investigations:

• Characterization of natural variation in uppP sequences across bacterial species

• Directed evolution studies to identify potential resistance mutations

• Genomic analysis of clinical isolates with varied antibiotic susceptibilities

• Development of resistance suppressor compounds

Translational Research Priorities:

Methodological Considerations for Drug Development:

• Develop in vitro assays with physiologically relevant conditions

• Implement cell-based screening systems for membrane permeability

• Conduct early ADME-Tox studies to prioritize compounds

• Design appropriate animal models that recapitulate human infections

By pursuing these research directions, investigations of Pseudomonas fluorescens Undecaprenyl-diphosphatase (uppP) can significantly contribute to the development of novel antibiotics and therapeutic strategies to address the growing threat of antibiotic-resistant infections.