Recombinant Pseudomonas fluorescens Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Introduction to ArnC

ArnC (UniProt ID: Q4KC83) is a membrane-associated glycosyltransferase encoded by the arnC gene in Pseudomonas fluorescens. It catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) from UDP-Ara4FN to undecaprenyl-phosphate (C55P), forming undecaprenyl-phospho-Ara4FN (C55P-Ara4FN). This lipid-linked intermediate is essential for the modification of lipid A in Gram-negative bacteria, enhancing resistance to host-derived antimicrobial peptides .

Recombinant Production

ArnC is expressed in E. coli using plasmid vectors optimized for high-yield soluble protein production. The gene (arnC) is cloned with a His-tag for affinity chromatography purification. Key steps include:

  • Expression Host: E. coli BL21(DE3) or similar strains.

  • Induction: IPTG-induced T7 promoter system.

  • Purification: Nickel-NTA chromatography followed by size-exclusion chromatography .

Enzymatic Mechanism and Pathway

ArnC operates within the arnBCADTEF operon, which mediates lipid A modification through the following steps:

  1. Substrate Binding: UDP-Ara4FN and undecaprenyl-phosphate bind to ArnC’s active site.

  2. Transfer Reaction: Ara4FN is transferred to undecaprenyl-phosphate, releasing UDP.

  3. Product Formation: C55P-Ara4FN is deformylated by ArnD to generate C55P-Ara4N, which is flipped to the periplasm and incorporated into lipid A via ArnT .

This pathway is critical for resistance to polymyxins and other cationic antimicrobial peptides .

Biotechnological Applications

  • Antimicrobial Resistance Studies: ArnC is a target for disrupting lipid A modification in multidrug-resistant pathogens .

  • Enzyme Kinetics: Used to characterize substrate specificity and inhibitor screening .

  • Structural Biology: Crystallization studies to resolve mechanisms of sugar transfer and membrane interaction .

Role in Polymyxin Resistance

Deletion of arnC in P. fluorescens abolishes Ara4FN transfer, impairing lipid A modification and restoring susceptibility to polymyxins .

Interaction with ArnD

ArnC’s product, C55P-Ara4FN, accumulates in arnD knockout strains, confirming that ArnD is the downstream deformylase .

Industrial Production Challenges

Recombinant ArnC requires optimized solubilization due to its membrane-associated nature. Glycerol (50%) and trehalose (6%) stabilize the protein during storage .

Table 2: Enzymatic Pathway of Lipid A Modification

StepEnzymeSubstrateProduct
1ArnBUDP-GlcUAUDP-Ara4FN
2ArnCUDP-Ara4FN + C55PC55P-Ara4FN + UDP
3ArnDC55P-Ara4FNC55P-Ara4N + formate
4ArnTC55P-Ara4N + lipid ALipid A-Ara4N + C55P

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type at the time of ordering for preferential development.
Synonyms
arnC; PFL_3044; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Target Names
arnC
Target Protein Sequence
MKPYPIQFVSIVIPVYNEEQSLPELLRRTEAACRQLKHEFEIVLVDDGSRDESANILQAA AEREDSPVVAVILNRNYGQHAAIMAGFEQCRGDVVITLDADLQNPPEEIPRLVAQAELGY DVVGTVRNNRQDSAFRRWPSKLINLAVQRSTGVAMSDYGCMLRAYRRTIIDAMLACTERS TFIPILANSFARHTTEVLVEHAEREHGDSKYSPMRLINLMFDLITCMTTTPLRLLSIIGF GMAGLGALFALMLIVLRLIFGATWAGDGTFVLFAVLFVFTGGQFIGMGLLGEYLGRMYSD VRARPRFFIEKVLRSQPAAPAPAVTVDGLTSTHTDQVSP
Uniprot No.

Target Background

Function

This recombinant Pseudomonas fluorescens undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC) catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) in bacterial systems?

ArnC is an integral membrane glycosyltransferase that catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (Ara4FN) from UDP to undecaprenyl phosphate (UndP). This modification enables the association of aminoarabinose with the bacterial inner membrane, which is a critical step in lipid A modification. The modified arabinose is ultimately attached to lipid A in Gram-negative bacteria, conferring resistance to polymyxin antibiotics and cationic antimicrobial peptides (CAMPs) . The enzyme plays a key role in the bacterial defense mechanism against these antimicrobial agents, making it an important target for research in combating antimicrobial resistance.

Why is Pseudomonas fluorescens considered a suitable host for recombinant protein production?

P. fluorescens possesses several advantageous characteristics that make it an efficient platform for recombinant protein production:

  • Biological safety: P. fluorescens is generally recognized as safe, having been consumed by humans for an extended period as it naturally occurs on plant surfaces .

  • Secretion systems: It contains an ABC transporter system (encoded by tliDEF) that can be exploited to transport recombinant proteins across the cell membrane, allowing for extracellular secretion of target proteins .

  • Psychrotrophic nature: As a psychrotrophic bacterium, P. fluorescens can grow at lower temperatures, which can be beneficial for the production of certain temperature-sensitive proteins .

  • Lower proteolytic activity: Compared to other bacterial expression systems, specific strains of P. fluorescens have been engineered with reduced proteolytic activity (e.g., P. fluorescens ΔtliA ΔprtA), which helps preserve the integrity of recombinant proteins .

These features collectively make P. fluorescens a valuable alternative to conventional expression systems like E. coli for certain applications, particularly when secretion of the target protein is desired.

What is the structural organization of ArnC and how does it relate to its function?

ArnC is a membrane-integrated glycosyltransferase with a distinctive structural organization that enables its catalytic activity. Cryo-electron microscopy structures of ArnC from S. enterica have revealed:

  • GT-A domain: Contains the catalytic core of the enzyme responsible for the glycosyltransferase activity.

  • Juxtamembrane (JM) helices: These structural elements play a crucial role in substrate coordination.

  • Conformational states: The enzyme exists in both apo and nucleotide-bound conformations, with significant differences between these states .

Upon binding of UDP (the partial donor substrate), ArnC undergoes a conformational transition characterized by a clamshell-like motion that brings the GT-A domain closer to the juxtamembrane helices of each protomer. This movement is essential for positioning the substrates correctly for catalysis . The UndP substrate threads between the juxtamembrane helices to reach the catalytic GT-A domain, where it can be positioned in either a "standby" position (P1) or a "catalysis" position (P2) .

What expression vector systems are most effective for producing recombinant ArnC in P. fluorescens?

For effective expression of recombinant ArnC in P. fluorescens, the pDART vector system offers significant advantages. This system was constructed by inserting the tliDEF genes (encoding the ABC transporter) along with the lipase ABC transporter recognition domain (LARD) into the shuttle vector pDSK519 .

The pDART system provides several methodological advantages:

  • Secretion capability: The C-terminally fused LARD allows the target protein to be secreted through the ABC transporter into the extracellular medium, eliminating the need for cell lysis.

  • Simplified purification: After secretion, the LARD containing a hydrophobic C-terminus enables purification through hydrophobic interaction chromatography (HIC) using a methyl-Sepharose column.

  • Broad host compatibility: The vector has been shown to function in various Pseudomonas species, increasing its versatility .

For optimal experimental design, researchers should consider:

  • Constructing the recombinant ArnC gene with the LARD fusion at the C-terminus

  • Using P. fluorescens ΔtliA ΔprtA as the host strain to minimize proteolytic degradation

  • Introducing the plasmid either through conjugation via E. coli S17-1 or by direct electroporation into P. fluorescens

The yield and activity of the recombinant ArnC can be significantly influenced by the choice of promoter, growth conditions (temperature, media composition), and induction parameters.

How can researchers effectively purify recombinant ArnC while maintaining its structural integrity and enzymatic activity?

Purifying membrane proteins like ArnC presents unique challenges due to their hydrophobic nature and potential instability when removed from the membrane environment. An effective purification protocol for recombinant ArnC should include:

  • Gentle membrane extraction:

    • Use mild detergents (such as n-dodecyl-β-D-maltoside or LMNG) to solubilize the membrane without denaturing the protein

    • Maintain buffer conditions that mimic the native environment (pH 7.0-7.5, inclusion of physiological salt concentrations)

  • Two-step purification approach:

    • If using the pDART expression system with LARD fusion, perform initial purification using hydrophobic interaction chromatography (HIC) with a methyl-Sepharose column

    • Follow with size exclusion chromatography to enhance purity and remove aggregates

  • Activity preservation measures:

    • Include metal ions (particularly Mn²⁺) in buffers, as these enable higher affinity for the UDP substrate

    • Add stabilizers such as glycerol (10-15%) to prevent protein denaturation

    • Consider incorporating lipid nanodiscs to maintain the protein in a membrane-like environment, similar to the approach used for structural determination of ArnC

  • Quality assessment:

    • Verify functional integrity through enzymatic assays measuring the transfer of Ara4FN from UDP to undecaprenyl phosphate

    • Use microscale thermophoresis (MST) to confirm substrate binding capability, as was demonstrated for the UDP binding to ArnC in the presence of Mn²⁺

Maintaining ArnC in lipid nanodiscs has proven particularly successful for structural studies and may represent an optimal approach for preserving both structure and function during and after purification .

What assay systems can be employed to measure ArnC enzymatic activity and substrate specificity?

Measuring the enzymatic activity of ArnC requires specialized assays that can detect the transfer of Ara4FN from UDP-Ara4FN to undecaprenyl phosphate. Several complementary approaches can be employed:

  • Radiometric assays:

    • Use radiolabeled UDP-Ara4FN (¹⁴C or ³H labeled) as the donor substrate

    • Measure the transfer of the radiolabeled Ara4FN to the lipid acceptor

    • Separate the lipid product by organic extraction or thin-layer chromatography

    • Quantify radioactivity in the lipid fraction using scintillation counting

  • LC-MS/MS analysis:

    • Detect the formation of undecaprenyl phosphate-Ara4FN and the release of UDP

    • Monitor reaction kinetics by sampling at multiple time points

    • Quantify substrate consumption and product formation simultaneously

  • Coupled enzyme assays:

    • Link ArnC activity to the release of UDP

    • Use UDP-glucose pyrophosphorylase and pyrophosphatase to convert UDP to UMP and inorganic phosphate

    • Detect inorganic phosphate using colorimetric methods (e.g., malachite green assay)

  • Binding affinity measurements:

    • Employ microscale thermophoresis (MST) to determine binding constants for substrates and cofactors

    • This approach has successfully shown that Mn²⁺ enables higher affinity binding of UDP to ArnC

  • Molecular dynamics simulations:

    • Complement experimental data with computational approaches

    • As demonstrated in research, coarse-grained and atomistic simulations can provide insights into substrate coordination before and during catalysis

For substrate specificity studies, researchers can test ArnC activity with various analogs of both the donor (modified UDP-Ara4FN derivatives) and acceptor (different polyprenyl phosphates) substrates to determine the structural requirements for recognition and catalysis.

What mechanisms underlie the catalytic activity of ArnC, and how do conformational changes influence substrate binding and product release?

The catalytic mechanism of ArnC involves a sophisticated interplay between conformational changes and substrate coordination. Based on structural and simulation studies, the following mechanistic model has emerged:

  • Initial binding events:

    • The acceptor substrate (UndP) threads through the juxtamembrane (JM) helices of an ArnC protomer

    • UndP is initially coordinated in position P1, the "standby" position, where it is stabilized by interactions with residues R128 and R137

  • Conformational rearrangement:

    • Binding of the donor substrate (UDP-Ara4FN) triggers a conformational change in the flexible β7-JM2 loop

    • This conformational shift enables UndP to move from P1 to P2, the "catalysis position"

  • Catalytic reaction:

    • In the P2 position, the phosphate group of UndP is positioned optimally relative to both the potential catalytic base D100 and the anomeric carbon of the Ara4FN sugar

    • The first aspartate of the DXD motif functions as a catalytic base to abstract a proton from UndP, activating it to perform the nucleophilic attack on the C1 carbon of Ara4FN

    • This results in the formation of a glycosidic bond between UndP and Ara4FN, with the concurrent release of UDP

  • Product release:

    • After the reaction, the newly formed UndP-Ara4FN product forces UndP to backtrack into a "product position"

    • This facilitates the release of the modified lipid back into the membrane

This entire process is facilitated by metal ion coordination, particularly Mn²⁺, which has been shown to enhance the binding affinity for UDP . The proposed catalytic mechanism likely operates similarly across all members of the polyprenyl phosphate glycosyltransferase (Pren-P GT) family, enabling the partially deprotonated UndP molecules to react with various donor substrates.

The table below summarizes the key residues involved in ArnC catalysis based on structural and simulation studies:

ResidueFunctionInteraction
R128UndP coordinationBinds phosphate group in P1 position
R137UndP coordinationBinds phosphate group in P1 position
D100Catalytic baseAbstracts proton from UndP phosphate
DXD motifMetal coordinationFirst D acts as catalytic base; second D coordinates metal ion
β7-JM2 loopConformational switchRearranges upon UDP binding to facilitate UndP movement

How does the expression of recombinant ArnC in P. fluorescens compare with expression in other bacterial systems in terms of yield, activity, and post-translational modifications?

Expressing membrane proteins like ArnC presents significant challenges across all bacterial expression systems. Comparative analysis reveals several important considerations when choosing P. fluorescens as an expression host versus other bacterial systems:

The table below summarizes the comparative advantages and limitations of different bacterial expression systems for recombinant ArnC:

Expression SystemAdvantagesLimitationsOptimization Strategies
P. fluorescens- ABC transporter secretion
- Lower proteolytic activity
- Growth at lower temperatures
- Potential for better folding
- Moderate yields
- Less genetic tools available
- Slower growth
- Use ΔtliA ΔprtA strain
- LARD fusion for purification
- Temperature optimization (18-25°C)
E. coli- High yields
- Extensive genetic tools
- Rapid growth
- Well-established protocols
- Inclusion body formation
- Different membrane composition
- Toxic effects possible
- Use C41/C43 strains
- Low IPTG concentration
- Low temperature induction
S. enterica- Native host for ArnC
- Natural membrane environment
- Native regulatory elements
- Pathogenicity concerns
- More stringent biosafety requirements
- Use attenuated strains
- Native promoter utilization

What are the most effective approaches for studying ArnC-substrate interactions and the conformational dynamics of the enzyme during catalysis?

Investigating ArnC-substrate interactions and conformational dynamics requires a multidisciplinary approach combining structural, biochemical, and computational methods:

  • Cryo-electron microscopy (cryo-EM):

    • Has successfully revealed ArnC structures in both apo and UDP-bound states

    • Can capture different conformational states during the catalytic cycle

    • The use of lipid nanodiscs provides a near-native membrane environment

    • Recent studies have shown that at matched particle counts, datasets collected at 200 kV and 300 kV differ negligibly in resolution

  • Molecular dynamics simulations:

    • Coarse-grained simulations have demonstrated how UndP threads through juxtamembrane helices to reach the catalytic site

    • Atomistic simulations with both substrates (UndP and UDP-Ara4FN) have identified different UndP coordination positions (P1 and P2)

    • These computational approaches complement experimental data and provide mechanistic insights

  • Microscale thermophoresis (MST):

    • Effective for measuring binding affinities of substrates and cofactors

    • Has shown that Mn²⁺ enhances UDP binding to ArnC

    • Can detect subtle changes in binding parameters under different conditions

  • Site-directed mutagenesis coupled with activity assays:

    • Systematic mutation of key residues identified in structural studies

    • Correlation of structural changes with alterations in enzyme kinetics

    • Validation of the proposed catalytic mechanism

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Can identify regions of conformational flexibility

    • Useful for mapping dynamic changes upon substrate binding

    • Complements static structural information from cryo-EM

  • Single-molecule FRET (smFRET):

    • Can capture real-time conformational changes during catalysis

    • Requires strategic placement of fluorophores on the protein

    • Potential to observe the clamshell-like motion identified in structural studies

  • Time-resolved studies:

    • Stopped-flow techniques combined with fluorescence detection

    • Temperature-jump methods to initiate conformational changes

    • Can provide kinetic information about binding and conformational transitions

A comprehensive experimental design might integrate these approaches as follows:

  • Use cryo-EM to capture different conformational states

  • Employ MD simulations to predict conformational transitions

  • Verify key interactions through site-directed mutagenesis and activity assays

  • Confirm dynamic aspects using HDX-MS or smFRET

  • Develop a unified model of ArnC's catalytic cycle that accounts for all experimental observations

How can researchers overcome challenges in structural determination of membrane proteins like ArnC using cryo-electron microscopy?

Structural determination of membrane proteins like ArnC presents unique challenges that require specialized approaches. The following methodological strategies can address these challenges:

The table below summarizes specific challenges encountered in ArnC structural studies and their solutions:

ChallengeSolution AppliedOutcome
Membrane protein stabilityLipid nanodiscsSuccessful structure determination in apo and UDP-bound states
Resolution limitationsMatching data collection parametersNo significant difference between 200 kV and 300 kV at matched particle counts
Conformational heterogeneity3D classificationIdentification of distinct conformational states
Substrate binding studiesInclusion of UDP and Mn²⁺Capture of nucleotide-bound conformation
Mechanistic understandingIntegration with MD simulationsIdentification of two UndP binding positions (P1 and P2)

Future improvements for ArnC structural studies might include alternative reconstruction algorithms, complex stabilization strategies, or physical improvements to grid preparation .

What approaches can be used to investigate the role of ArnC in antimicrobial resistance and to develop inhibitors targeting this enzyme?

Investigating ArnC's role in antimicrobial resistance and developing effective inhibitors requires a multifaceted approach spanning molecular, cellular, and in vivo studies:

  • Genetic manipulation studies:

    • Creation of arnC knockout strains to assess changes in polymyxin susceptibility

    • Complementation studies with wild-type and mutant arnC to establish structure-function relationships

    • CRISPR interference (CRISPRi) for conditional knockdown to study essentiality under different conditions

  • Resistance phenotype characterization:

    • Minimum inhibitory concentration (MIC) determination for polymyxins and other cationic antimicrobial peptides in wild-type versus arnC-deficient strains

    • Lipid A modification analysis using mass spectrometry to correlate with resistance phenotypes

    • Membrane permeability assays to assess the physical basis of resistance

  • High-throughput screening approaches:

    • Development of cell-based assays to identify compounds that sensitize bacteria to polymyxins

    • In vitro enzymatic assays using purified ArnC to screen for direct inhibitors

    • Fragment-based drug discovery utilizing the structural information available for ArnC

  • Structure-based inhibitor design:

    • Virtual screening against the UDP binding site or novel allosteric sites identified in structural studies

    • Design of substrate analogs that compete with either UDP-Ara4FN or UndP

    • Focus on targeting the conformational transition that occurs upon UDP binding

  • Mechanistic validation of inhibitors:

    • Binding studies using MST or isothermal titration calorimetry (ITC)

    • Structural studies of ArnC-inhibitor complexes using cryo-EM

    • Molecular dynamics simulations to understand inhibitor binding modes and effects on protein dynamics

  • In vivo efficacy studies:

    • Combination studies with polymyxins and ArnC inhibitors

    • Mouse infection models to validate the approach in a physiologically relevant context

    • Resistance development monitoring to assess the barrier to resistance

The following table outlines potential inhibitor development strategies based on structural and mechanistic insights:

Target SiteRationaleInhibitor TypeAdvantage
UDP binding sitePrevents nucleotide binding required for catalysisCompetitive inhibitorsEstablished druggable pocket with structural data available
UndP binding regionBlocks acceptor substrate accessLipid mimeticsPotential for high specificity
Conformational transitionLocks enzyme in inactive conformationAllosteric inhibitorsMay provide higher selectivity and novel intellectual property
Metal coordination siteDisrupts essential Mn²⁺ bindingMetal chelatorsCould be broadly effective against related enzymes
JM helicesPrevents UndP threadingTransmembrane domain bindersNovel approach targeting protein-membrane interface

How can researchers effectively analyze the interaction between ArnC function and bacterial membrane composition in relation to antibiotic resistance mechanisms?

Understanding the complex relationship between ArnC function, membrane composition, and antibiotic resistance requires integrated analytical approaches that span from molecular to cellular scales:

  • Lipidomic analysis techniques:

    • Liquid chromatography-mass spectrometry (LC-MS/MS): Enables comprehensive profiling of membrane lipids, including modified lipid A species containing Ara4FN

    • MALDI-TOF MS: Particularly useful for direct analysis of lipid A modifications with minimal sample preparation

    • Stable isotope labeling: Can track the incorporation of Ara4FN into lipid A in real-time

  • Membrane biophysical property assessment:

    • Differential scanning calorimetry (DSC): Measures changes in membrane phase transitions due to lipid A modifications

    • Atomic force microscopy (AFM): Provides nanoscale visualization of membrane structures and mechanical properties

    • Fluorescence anisotropy: Assesses membrane fluidity changes resulting from ArnC-mediated modifications

  • Antimicrobial peptide-membrane interaction studies:

    • Surface plasmon resonance (SPR): Quantifies binding of polymyxins to membranes with varying levels of Ara4FN-modified lipid A

    • Fluorescence microscopy with labeled antimicrobials: Visualizes the localization and penetration of polymyxins in bacterial membranes

    • Leakage assays: Measures membrane permeabilization efficiency by polymyxins against modified versus unmodified membranes

  • Reconstitution experiments:

    • Proteoliposomes with defined lipid composition: Allows controlled study of ArnC activity in different membrane environments

    • In vitro lipid A modification systems: Reconstitutes the complete Ara4FN transfer pathway to study cooperative effects

    • Nanodiscs with varying lipid compositions: Enables study of how membrane properties affect ArnC structure and function

  • Correlative approaches:

    • Transcriptomics combined with lipidomics: Links gene expression changes with membrane composition alterations under antibiotic stress

    • Membrane proteomics: Identifies changes in membrane protein composition that may work synergistically with lipid A modifications

    • Single-cell analysis: Examines heterogeneity in resistance mechanisms within bacterial populations

The table below summarizes how different membrane parameters affect ArnC function and antibiotic resistance:

Membrane ParameterEffect on ArnC FunctionImpact on Antibiotic ResistanceAnalytical Method
Lipid compositionInfluences enzyme stability and activityModulates baseline susceptibility to polymyxinsLipidomics (LC-MS/MS)
Membrane fluidityAffects substrate accessibility and enzyme mobilityAlters antimicrobial peptide insertion kineticsFluorescence anisotropy
Surface chargeImpacts electrostatic interactions with substratesCritical determinant of polymyxin bindingZeta potential measurements
Lipid domainsMay create localized environments for efficient catalysisCould serve as resistance hotspotsSuper-resolution microscopy
Membrane thicknessInfluences optimal positioning of transmembrane domainsAffects antimicrobial peptide penetrationSmall-angle X-ray scattering

An integrated experimental framework might include:

  • Establishing how environmental conditions affect membrane composition

  • Determining how these changes influence ArnC activity and localization

  • Measuring the resulting modifications to lipid A

  • Correlating these modifications with polymyxin resistance profiles

  • Developing predictive models of resistance based on membrane composition data

How can recombinant ArnC be utilized to develop novel screening systems for antimicrobial resistance research?

Recombinant ArnC from P. fluorescens represents a valuable tool for developing innovative screening platforms for antimicrobial resistance research, particularly for polymyxin resistance. Several methodological approaches can be implemented:

  • Cell-based reporter systems:

    • Engineer bacterial strains with fluorescent or luminescent reporters linked to arnC expression

    • These systems can detect conditions or compounds that modulate arnC activity

    • P. fluorescens-based systems offer advantages due to their non-pathogenic nature and efficient protein expression capabilities

  • In vitro high-throughput screening platforms:

    • Develop enzymatic assays using purified recombinant ArnC to screen for inhibitors

    • Couple ArnC activity to fluorescent or colorimetric readouts for rapid detection

    • Design counterscreens to identify compounds that specifically target ArnC rather than related glycosyltransferases

  • Biosensor development:

    • Create biosensors using recombinant ArnC to detect environmental conditions that trigger polymyxin resistance

    • Implement FRET-based sensors that report on ArnC conformational changes upon substrate binding

    • These tools could help monitor resistance development in clinical or environmental samples

  • Structural biology platforms:

    • Utilize the established methods for ArnC structural determination to screen for compounds that lock the enzyme in inactive conformations

    • Deploy fragment-based approaches to identify novel binding sites not apparent from apo structures

    • The successful use of lipid nanodiscs for ArnC structural studies provides a template for similar approaches with other membrane resistance determinants

  • Resistance mechanism discovery:

    • Apply recombinant ArnC systems to identify new regulatory mechanisms controlling lipid A modification

    • Screen for genetic factors that influence ArnC expression, localization, or activity

    • Investigate potential cross-talk between different resistance mechanisms

The table below outlines specific screening approaches and their applications:

Screening ApproachMethodologyApplicationAdvantages
ArnC activity inhibitionFRET-based enzymatic assayInhibitor discoveryDirect measurement of enzymatic activity
ArnC-substrate interactionMicroscale thermophoresisSubstrate analog developmentQuantitative binding affinity determination
Conformational state monitoringDEER spectroscopyAllosteric modulator discoveryCaptures dynamic aspects of protein function
Cellular lipid A modificationMass spectrometryWhole-cell inhibitor screeningAccounts for compound penetration and efflux
Reporter gene fusionFluorescence/luminescenceEnvironmental trigger identificationHigh-throughput compatible

These screening platforms would benefit from the integration of recombinant P. fluorescens expression systems with emerging technologies in structural biology, synthetic biology, and high-content screening approaches.

What potential exists for engineering modified versions of ArnC with altered substrate specificity or enhanced catalytic efficiency?

The availability of detailed structural and mechanistic information about ArnC opens numerous possibilities for protein engineering to create variants with novel properties. Several strategic approaches can be pursued:

  • Structure-guided mutagenesis:

    • Target the substrate binding pockets based on the identified UndP binding positions (P1 and P2)

    • Modify the flexible β7-JM2 loop involved in the conformational rearrangement upon UDP binding

    • Engineer variants with altered metal ion preferences beyond the native Mn²⁺ dependence

  • Catalytic efficiency enhancement:

    • Optimize the positioning of the catalytic base (D100) to improve proton abstraction from UndP

    • Modify residues involved in transition state stabilization

    • Engineer variants with reduced product inhibition by altering the "product position" interactions

  • Substrate specificity engineering:

    • Modify the donor substrate binding pocket to accommodate alternative UDP-sugars

    • Alter the acceptor binding site to recognize different polyprenyl phosphates

    • Create chimeric enzymes combining domains from related glycosyltransferases

  • Stability and expression improvement:

    • Introduce disulfide bonds or salt bridges to enhance thermostability

    • Optimize the hydrophobic interfaces between transmembrane segments

    • Implement consensus design approaches based on sequence alignments of related proteins

  • Novel functionality introduction:

    • Engineer bifunctional enzymes combining ArnC activity with other steps in the lipid A modification pathway

    • Create switchable variants responsive to specific environmental signals

    • Develop engineered ArnC that can transfer alternative antimicrobial resistance determinants

The table below summarizes potential engineering targets and expected outcomes:

Engineering TargetApproachExpected OutcomeApplication
Donor specificityMutation of UDP-Ara4FN binding residuesTransfer of alternative sugarsNovel glycoconjugate synthesis
Acceptor rangeModification of UndP binding channelRecognition of shorter/longer lipid carriersExpanded substrate scope
Catalytic rateOptimization of transition state geometryIncreased kcatImproved biocatalyst efficiency
ThermostabilityRigidification of flexible regionsEnhanced temperature toleranceIndustrial biocatalysis
Expression yieldCodon optimization, signal sequence engineeringHigher protein productionSimplified purification
Conformational controlIntroduction of allosteric switchesActivity responsive to specific signalsBiosensor development

Implementing these engineering strategies would require an iterative approach:

  • Conduct computational design to identify promising mutations

  • Generate and screen libraries of variants

  • Characterize successful candidates using biochemical and structural methods

  • Further refine based on experimental feedback

The P. fluorescens expression system, with its advantages for membrane protein production and potential for secretion, provides an excellent platform for expressing and screening these engineered variants .

How might research on ArnC contribute to our understanding of broader mechanisms of antimicrobial resistance and inform the development of new therapeutic strategies?

Research on ArnC provides insights that extend beyond this specific enzyme to inform our understanding of antimicrobial resistance mechanisms more broadly, potentially guiding new therapeutic approaches:

  • Membrane modification resistance strategies:

    • ArnC represents one of several enzymes involved in lipid A modification systems that protect against antimicrobial peptides

    • Understanding this pathway illuminates a conserved strategy employed by many Gram-negative pathogens

    • This knowledge can inform approaches to target multiple modification pathways simultaneously to overcome resistance

  • Resistance mechanism conservation and divergence:

    • Comparative analysis of ArnC across different bacterial species reveals both conserved catalytic mechanisms and species-specific adaptations

    • The proposed catalytic mechanism for ArnC likely operates similarly across all members of the polyprenyl phosphate glycosyltransferase family

    • This evolutionary perspective helps identify vulnerabilities common to multiple pathogens

  • Antibiotic combination strategies:

    • Inhibitors targeting ArnC could restore sensitivity to polymyxins in resistant strains

    • Understanding the regulatory networks controlling arnC expression may reveal adjuvant targets that downregulate resistance mechanisms

    • The association between P. fluorescens and human diseases, including antibody development in Crohn's disease patients, suggests broader implications for host-microbe interactions

  • Novel antimicrobial design principles:

    • Detailed knowledge of how bacteria modify their surface structures to resist antimicrobials can guide the design of next-generation antimicrobials that circumvent these modifications

    • Understanding the molecular basis of resistance can inform the development of antimicrobials less susceptible to specific resistance mechanisms

  • Diagnostic applications:

    • Knowledge of specific resistance determinants like ArnC can enable the development of molecular diagnostic tools to rapidly identify resistant strains

    • Such diagnostics could guide more precise antimicrobial therapy

The table below outlines how ArnC research contributes to broader antimicrobial resistance strategies:

Research AreaContribution from ArnC StudiesTherapeutic Implication
Resistance mechanismsDetailed understanding of lipid A modificationTargeted inhibition of resistance pathways
Structural biologyMembrane protein catalytic mechanismsStructure-based drug design principles
Bacterial physiologyRole of membrane modifications in resistanceIdentification of new vulnerability targets
Host-pathogen interactionImpact of modified bacterial surfaces on immune recognitionImmune-modulating therapeutic approaches
One Health perspectiveEnvironmental reservoir understanding (P. fluorescens in soil/rhizosphere) Ecological approaches to resistance management

Future research directions might include:

  • Comparative genomic and functional studies of ArnC across diverse bacterial species

  • Investigation of the interplay between different resistance mechanisms

  • Exploration of host factors that interact with modified bacterial surfaces

  • Development of broad-spectrum inhibitors targeting conserved features of resistance enzymes

  • Integration of ArnC research into systems biology models of antimicrobial resistance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.