Recombinant Pseudomonas fluorescens UPF0060 membrane protein Pfl01_4105 (Pfl01_4105)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its implementation.
Synonyms
Pfl01_4105; UPF0060 membrane protein Pfl01_4105
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain Pf0-1)
Target Names
Pfl01_4105
Target Protein Sequence
MLNYLWFFLAALFEIAGCFAFWMWLRQGKSALWVIPALISLTLFALLLTRVEATYAGRAY AAYGGIYIIASIGWLAVVERIRPLGSDWIGVALCVIGATVILFGPRFSAS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0060 membrane protein Pfl01_4105 in Pseudomonas fluorescens?

The UPF0060 membrane protein Pfl01_4105 is a membrane-associated protein in Pseudomonas fluorescens with an uncharacterized protein family (UPF) designation, indicating that its precise function remains to be fully elucidated. Like other membrane proteins, it is likely integrated into the bacterial cell membrane and may play roles in cellular processes such as transport, signaling, or structural support of the membrane. Similar to other P. fluorescens proteins such as filamentous hemagglutinin (FHA), it may be involved in bacterial pathogenicity, host cell interactions, or environmental adaptation mechanisms .

How is recombinant Pfl01_4105 protein typically produced for research purposes?

Recombinant Pfl01_4105 protein is typically produced using heterologous expression systems, most commonly in Escherichia coli strains like BL21(DE3) as described in similar P. fluorescens protein studies . The general methodology involves:

  • Amplification of the Pfl01_4105 gene from P. fluorescens genomic DNA using PCR with specific primers

  • Cloning into expression vectors containing affinity tags (such as His-tag)

  • Transformation into E. coli expression hosts

  • Induction of protein expression using IPTG or similar inducers

  • Cell lysis and protein purification via affinity chromatography

  • Verification of protein identity and purity using SDS-PAGE and Western blotting

For membrane proteins, special considerations include using detergents during purification to maintain proper folding and solubility, as well as potentially employing specialized E. coli strains designed for membrane protein expression.

What are the challenges in expressing and purifying membrane proteins like Pfl01_4105?

Membrane proteins like Pfl01_4105 present several challenges during expression and purification:

ChallengeDescriptionPotential Solution
Toxicity to hostOverexpression can disrupt host cell membranesUse tightly regulated expression systems with lower induction levels
Protein aggregationTendency to form inclusion bodiesExpress at lower temperatures (16-20°C); add solubilizing agents
Low yieldInefficient translation of membrane proteinsOptimize codon usage; use specialized expression strains
Proper foldingDifficulty maintaining native conformationAdd membrane-mimicking environments (detergents, liposomes)
StabilityRapid degradation during purificationInclude protease inhibitors; optimize buffer conditions

Similar challenges have been encountered with other P. fluorescens proteins, where researchers have employed specialized protocols to maintain protein stability and functionality . For instance, when working with iron-responsive proteins from P. fluorescens, researchers have added specific agents to the purification buffers to maintain proper protein conformation.

How does the structure of Pfl01_4105 contribute to its function in P. fluorescens?

The structure-function relationship of Pfl01_4105 can be investigated using approaches similar to those employed for other membrane proteins in P. fluorescens:

  • Structural analysis: Using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy to determine three-dimensional structure

  • Domain prediction: Bioinformatic analysis to identify conserved domains and predict their functions

  • Mutational studies: Systematic mutation of key residues to determine their impact on protein function

  • Protein-protein interaction analysis: Identifying binding partners using techniques like pull-down assays or co-immunoprecipitation

As demonstrated in studies of P. fluorescens FHA, the presence of specific domains can be critical for functions such as biofilm formation, host cell adhesion, and bacterial aggregation . Similar domain-specific analyses of Pfl01_4105 could reveal its functional mechanisms within the bacterial membrane.

What roles might Pfl01_4105 play in Pseudomonas fluorescens pathogenicity or environmental adaptation?

Based on research with other P. fluorescens membrane proteins, Pfl01_4105 may contribute to:

  • Host-pathogen interactions: Similar to FHA, which mediates attachment to host cells and induces hemagglutination

  • Biofilm formation: Potentially involved in the production of extracellular matrix and bacterial aggregation

  • Environmental sensing: Possibly functioning as a receptor or channel responding to environmental stimuli

  • Stress response: May be involved in adaptation to stressors such as iron limitation, as observed with other P. fluorescens proteins

To investigate these potential roles, researchers could employ experimental approaches similar to those used for FHA, including:

  • Creation of knockout mutants (e.g., Pfl01_4105-defective strains)

  • Comparative phenotypic analysis of wild-type and mutant strains

  • In vitro assays for biofilm formation, host cell adhesion, and stress response

  • In vivo infection models to assess virulence and pathogenicity

How does iron availability affect Pfl01_4105 expression and function?

Given that other P. fluorescens proteins have shown iron-responsive behavior , researchers could investigate Pfl01_4105's relationship with iron through:

  • Expression analysis: Quantifying Pfl01_4105 expression levels under iron-replete and iron-limited conditions using qRT-PCR

  • Proteomic profiling: Using 2D gel electrophoresis and mass spectrometry to identify changes in protein abundance under different iron conditions

  • Iron-binding assays: Determining whether Pfl01_4105 directly binds iron or interacts with iron-binding compounds

  • Regulatory mechanism investigation: Identifying potential iron-responsive regulatory elements in the Pfl01_4105 gene promoter

In P. fluorescens studies, iron limitation can be experimentally induced using iron chelators such as 2,2'-dipyridyl at concentrations around 600 μM . Similar experimental designs could be applied to study Pfl01_4105's iron responsiveness.

What experimental design considerations are most important when studying Pfl01_4105?

When designing experiments to study Pfl01_4105, researchers should consider:

  • Variable selection: Carefully select independent variables (e.g., growth conditions, iron availability) and dependent variables (e.g., protein expression, phenotypic outcomes) based on research questions

  • Controls: Include appropriate controls for genetic manipulations, protein expression, and functional assays

  • Replication: Ensure sufficient biological and technical replicates to achieve statistical power

  • Environmental factors: Control for variables that might affect protein expression or function, such as temperature, pH, and media composition

  • Statistical optimization: Consider factorial or response surface designs to efficiently explore multiple factors affecting Pfl01_4105

The experimental design should aim to establish validity, reliability, and replicability while achieving appropriate levels of statistical power and sensitivity . For membrane proteins like Pfl01_4105, special consideration should be given to extraction and purification conditions to maintain native protein structure.

How can gene knockout or mutation approaches be used to study Pfl01_4105 function?

To study Pfl01_4105 function through genetic manipulation, researchers could employ strategies similar to those used for other P. fluorescens proteins:

  • Targeted gene deletion: Using overlap extension PCR to create in-frame deletions of Pfl01_4105

  • Site-directed mutagenesis: Introducing specific mutations to alter key domains or residues

  • Complementation studies: Reintroducing wild-type or mutated versions of Pfl01_4105 to confirm phenotypic changes

  • Reporter gene fusions: Creating Pfl01_4105-reporter constructs to monitor expression under different conditions

For example, to create a Pfl01_4105-defective strain, researchers could:

  • Amplify fragments upstream and downstream of the target region

  • Join these fragments using overlap extension PCR

  • Clone the resulting fragment into a suicide vector (e.g., pGP704)

  • Introduce the construct into P. fluorescens through conjugation with E. coli S17-1 λpir

  • Select for homologous recombination events using appropriate antibiotics

  • Confirm the mutation through PCR and sequencing

What are the best methods for detecting and visualizing Pfl01_4105 in bacterial cells?

For detection and visualization of Pfl01_4105, researchers can employ techniques similar to those used for other P. fluorescens proteins:

TechniqueApplicationAdvantagesLimitations
Immunofluorescence microscopyVisualizing protein localizationPreserves cellular context; shows spatial distributionRequires specific antibodies; potential fixation artifacts
Western blottingDetecting protein expressionQuantifiable; confirms protein sizeLoses spatial information; requires cell lysis
Flow cytometryAnalyzing protein expression in populationsHigh-throughput; statistical powerLimited spatial resolution; requires fluorescent tagging
GFP fusion proteinsLive-cell visualizationReal-time monitoring; minimal processingMay affect protein function; background fluorescence

As demonstrated with FHA protein localization, immunofluorescence microscopy can effectively show protein distribution on the bacterial surface using specific antibodies and FITC-conjugated secondary antibodies, with DAPI counterstaining to visualize bacterial cells .

How should researchers analyze and interpret phenotypic changes in Pfl01_4105 mutants?

When analyzing phenotypic changes in Pfl01_4105 mutants compared to wild-type P. fluorescens, researchers should:

  • Quantitative assessment: Measure and statistically analyze multiple parameters such as:

    • Growth rates in various media

    • Biofilm formation capacity

    • Motility characteristics

    • Stress resistance profiles

    • Host cell adhesion ability

    • Virulence in appropriate infection models

  • Comparative analysis: Similar to studies with FHA mutants, compare Pfl01_4105 mutants with wild-type strains across multiple timepoints and conditions

  • Statistical rigor: Apply appropriate statistical tests (t-tests, ANOVA, non-parametric tests) with corrections for multiple comparisons

  • Temporal dynamics: Assess changes over time, especially for processes like biofilm formation or host colonization

  • Controls for complementation: Include genetic complementation studies to confirm that observed phenotypes are specifically due to Pfl01_4105 mutation

For example, when analyzing bacterial dissemination in infection models, researchers might collect data similar to the following hypothetical table:

Time post-infectionWild-type bacterial count (CFU/g)Pfl01_4105 mutant count (CFU/g)P-value
12 hours5.7 × 10⁴ ± 0.8 × 10⁴0.9 × 10⁴ ± 0.3 × 10⁴< 0.001
24 hours2.3 × 10⁵ ± 0.5 × 10⁵1.1 × 10⁴ ± 0.4 × 10⁴< 0.001
48 hours8.7 × 10⁶ ± 1.2 × 10⁶3.2 × 10⁴ ± 0.7 × 10⁴< 0.001

What bioinformatic approaches can provide insights into Pfl01_4105's potential functions?

Bioinformatic analyses can provide valuable insights into potential functions of uncharacterized proteins like Pfl01_4105:

  • Sequence homology analysis: Compare Pfl01_4105 with characterized proteins across bacterial species to identify functional homologs

  • Domain prediction: Use tools like NCBI's conserved domain search to identify functional domains within the protein

  • Structural prediction: Apply tools like AlphaFold or I-TASSER to predict 3D structure

  • Subcellular localization prediction: Use programs like PSORTb to confirm membrane localization

  • Genomic context analysis: Examine neighboring genes for functional relationships, potential operons, or co-regulated genes

  • Phylogenetic analysis: Construct phylogenetic trees to understand evolutionary relationships with similar proteins

  • Protein-protein interaction prediction: Use tools like STRING to predict potential interaction partners

These analyses should be conducted systematically, with results integrated to generate testable hypotheses about Pfl01_4105 function that can be validated experimentally.

How can researchers resolve contradictory data about Pfl01_4105 function?

When faced with contradictory data regarding Pfl01_4105 function, researchers should:

  • Methodological examination: Carefully review experimental methods for potential sources of variability:

    • Differences in strain backgrounds

    • Variation in growth or assay conditions

    • Methodological inconsistencies

    • Reagent quality or specificity issues

  • Independent validation: Confirm key findings using alternative techniques or approaches

  • Strain construction verification: Verify genetic manipulations through sequencing and phenotypic analysis

  • Biological context consideration: Consider whether contradictions might reflect:

    • Multifunctional nature of the protein

    • Context-dependent functions

    • Indirect effects versus direct mechanisms

    • Strain-specific differences

  • Systematic reconciliation: Design experiments specifically to address and resolve contradictions:

    • Side-by-side comparisons under identical conditions

    • Isolation of individual variables

    • Development of more sensitive or specific assays

For instance, researchers studying P. fluorescens proteins have resolved contradictory findings about virulence factors by performing parallel infection analyses with multiple bacterial strains and complementation studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.