Recombinant Pseudomonas fluorescens UPF0114 protein PFLU_5318 (PFLU_5318)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PFLU_5318; UPF0114 protein PFLU_5318
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Pseudomonas fluorescens (strain SBW25)
Target Names
PFLU_5318
Target Protein Sequence
MERFIENAMYASRWLLAPIYFGLSLGLLALALKFFQEVIHLLPSVFSMAESELILVLLSL IDMALVGGLLVMVMISGYENFVSQLDIDDNKEKLNWLGTMDSSSLKMKVAASIVAISSIH LLRIFMDAKNVDPQHLMWYVIIHMTFVVSAFAMGYLDKVTKH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should PFLU_5318 protein be stored and handled in laboratory settings?

The proper storage and handling of PFLU_5318 protein is critical for maintaining its stability and functionality in research applications. The protein is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt . Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity .

For reconstitution, the following methodological approach is recommended:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (standard is 50%)

  • Prepare small aliquots for long-term storage at -20°C/-80°C

This procedure minimizes protein degradation and maintains sample viability over extended research periods .

What experimental controls should be included when working with recombinant PFLU_5318?

When designing experiments with recombinant PFLU_5318, appropriate controls are essential for valid and reliable results. A comprehensive experimental design should include:

  • Negative controls:

    • Buffer-only samples without protein

    • E. coli host strain without the inserted PFLU_5318 gene

    • Non-related recombinant protein expressed in the same system

  • Positive controls:

    • Known functional proteins from the same family (if available)

    • Previously validated PFLU_5318 sample (if available)

  • Technical controls:

    • His-tag only protein to account for tag-related effects

    • Batch validation samples to ensure consistency between experiments

This control scheme follows established principles in experimental design, ensuring that observed effects can be reliably attributed to PFLU_5318 rather than experimental artifacts or contaminants .

How can evolutionary experimental approaches be applied to study PFLU_5318 function?

Evolutionary experimental approaches offer powerful methods for elucidating PFLU_5318 function through directed evolution and selection experiments. A methodological framework includes:

  • Establishing baseline cultures:

    • Prepare experimental cultures (E1, E2) and control culture (C) using isolated P. fluorescens colonies

    • Culture in appropriate medium (such as Queen's B Medium) with proper environmental conditions

  • Implementing selective pressure:

    • Design selection systems that might reveal PFLU_5318 function (e.g., nutrient limitation, stress conditions, or competitive environments)

    • Use solid surface attachment methods (such as polystyrene beads) to select for biofilm formation capabilities

  • Monitoring evolutionary changes:

    • Perform serial transfers under continued selection

    • Monitor changes through both phenotypic observations and genotypic analysis

    • Sequence the PFLU_5318 gene region to identify adaptive mutations

  • Comparative analysis:

    • Compare evolved populations with the ancestral strain

    • Perform complementation tests with wild-type PFLU_5318 in evolved strains showing mutations

This experimental evolution approach can reveal functional insights by identifying conditions where PFLU_5318 confers adaptive advantages, particularly in bacterial attachment, stress response, or metabolic adaptation scenarios .

What are the predicted structural features of PFLU_5318 and how do they inform functional hypotheses?

Analysis of the PFLU_5318 amino acid sequence reveals several structural features that provide insights into potential functions:

Structural FeatureDescriptionFunctional Implication
Transmembrane domainsThe sequence "LLAPIYFGLSLGLLALALK" and similar hydrophobic stretches suggest membrane-spanning regionsLikely membrane-associated protein with potential roles in transport or signaling
Conserved motifsRegions with high conservation across UPF0114 family membersCritical for the core function of the protein family
Signal peptideN-terminal region analysis (first 20-30 aa)Possible secretion or membrane targeting
Secondary structurePrediction of α-helices (e.g., "IDMALVGGLLVMVMISGY")Membrane integration or protein-protein interaction interfaces

These structural predictions should be experimentally validated through techniques such as:

  • Membrane fraction isolation and Western blotting

  • Fluorescent protein tagging and localization studies

  • Circular dichroism spectroscopy for secondary structure confirmation

  • Cross-linking studies to identify interaction partners

The membrane-associated nature of PFLU_5318 suggests potential roles in nutrient sensing, stress response, or biofilm formation pathways that are characteristic of Pseudomonas species adaptation mechanisms .

How can contradictions in PFLU_5318 functional data be reconciled through comprehensive experimental design?

Researchers may encounter contradictory results regarding PFLU_5318 function due to variations in experimental conditions, genetic backgrounds, or analytical methods. A systematic approach to reconcile these contradictions includes:

  • Standardization of experimental conditions:

    • Define precise growth conditions (temperature, medium composition, oxygen levels)

    • Standardize protein expression and purification protocols

    • Establish consistent assay procedures across laboratories

  • Multi-level analysis approach:

    • Transcriptional analysis: RNA-seq to identify co-regulated genes

    • Proteomic analysis: Identify interaction partners through co-immunoprecipitation

    • Metabolomic analysis: Detect metabolic changes in knockout vs. wild-type strains

    • Phenotypic analysis: Screen for condition-specific growth defects

  • Genetic complementation strategy:

    • Create clean deletion mutants using precise molecular techniques

    • Perform complementation with wild-type gene under native promoter

    • Test complementation with mutated versions targeting specific domains

  • Cross-species validation:

    • Test functional conservation in related Pseudomonas species

    • Perform heterologous expression in model organisms

This comprehensive approach addresses the multifaceted nature of protein function and helps distinguish between direct and indirect effects, primary and secondary functions, and condition-specific roles that may explain apparent contradictions in published data .

What is the optimal protocol for expressing and purifying recombinant PFLU_5318?

The expression and purification of recombinant PFLU_5318 requires careful optimization to ensure high yield and purity. A methodological approach includes:

  • Expression system selection:

    • E. coli BL21(DE3) is commonly used for recombinant expression

    • Consider codon optimization for the P. fluorescens sequence in E. coli

    • Evaluate different fusion tags beyond His-tag if purification challenges arise

  • Culture conditions optimization:

    • Test induction parameters (IPTG concentration: 0.1-1.0 mM)

    • Evaluate induction temperature (16°C, 25°C, 37°C)

    • Determine optimal induction time (4h, 8h, overnight)

  • Purification strategy:

    • Primary purification: Ni-NTA affinity chromatography for His-tagged protein

    • Secondary purification: Size exclusion chromatography for higher purity

    • Consider ion exchange chromatography if contaminating proteins persist

  • Quality control assessment:

    • SDS-PAGE analysis (expected >90% purity)

    • Western blot confirmation with anti-His antibodies

    • Mass spectrometry verification of intact protein

    • Functional assays to confirm activity

This optimized protocol ensures the production of high-quality recombinant PFLU_5318 suitable for downstream structural and functional analyses, with expected yields of 5-10 mg/L of bacterial culture under optimal conditions .

How can researchers design experiments to elucidate the role of PFLU_5318 in biofilm formation?

Biofilm formation represents a critical adaptation mechanism in Pseudomonas species. To investigate PFLU_5318's potential role in this process, researchers should implement a multi-faceted experimental approach:

  • Genetic manipulation strategies:

    • Generate clean deletion mutants (ΔPFLU_5318)

    • Create overexpression strains under inducible promoters

    • Develop fluorescently tagged versions for localization studies

  • Quantitative biofilm assays:

    • Static microtiter plate crystal violet assays (96-well format)

    • Flow cell continuous culture systems for dynamic biofilm formation

    • Confocal laser scanning microscopy for structural analysis

    • Bead attachment assays to quantify initial adhesion

  • Environmental condition matrix:

    • Test biofilm formation under various nutritional conditions

    • Evaluate temperature effects (range: 4°C to 37°C)

    • Assess responses to relevant stress conditions (oxidative, osmotic)

  • Molecular analysis of biofilm components:

    • Quantify extracellular polymeric substance (EPS) production

    • Analyze protein composition of biofilm matrix

    • Evaluate gene expression changes during biofilm development

The implementation of white polystyrene beads as surfaces for bacterial attachment provides a quantifiable method for assessing biofilm formation capabilities, as detailed in experimental evolution protocols for P. fluorescens . This approach allows researchers to isolate and characterize adaptive variants with altered biofilm formation phenotypes that may highlight PFLU_5318 function.

What analytical methods are most appropriate for studying protein-protein interactions involving PFLU_5318?

Understanding PFLU_5318's interaction network is crucial for elucidating its biological function. The following analytical methods provide complementary approaches for comprehensive protein-protein interaction analysis:

  • In vitro interaction methods:

    • Pull-down assays using purified His-tagged PFLU_5318

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Analytical ultracentrifugation for complex formation

  • In vivo interaction approaches:

    • Bacterial two-hybrid system adapted for Pseudomonas

    • Co-immunoprecipitation with tagged PFLU_5318

    • Proximity labeling methods (e.g., BioID or APEX)

    • Fluorescence resonance energy transfer (FRET) for direct interaction

  • High-throughput screening approaches:

    • Yeast two-hybrid library screening

    • Protein microarrays with recombinant PFLU_5318

    • Mass spectrometry-based interactome analysis

  • Computational prediction and validation:

    • Sequence-based interaction prediction

    • Structural modeling of potential interaction interfaces

    • Conservation analysis across Pseudomonas species

For each identified interaction, validation through multiple independent methods is essential to minimize false positives. Additionally, researchers should consider the native membrane-associated context of PFLU_5318 when designing interaction studies, as improper solubilization may disrupt physiologically relevant interactions .

How should researchers analyze phenotypic variations in PFLU_5318 mutant strains?

Phenotypic analysis of PFLU_5318 mutant strains requires rigorous statistical approaches and comprehensive characterization methods:

  • Experimental design considerations:

    • Use multiple biological replicates (minimum n=3)

    • Include technical replicates for each biological replicate

    • Implement appropriate controls (wild-type, vector-only, unrelated gene mutants)

    • Design factorial experiments to test condition interactions

  • Quantitative phenotypic measurements:

    • Growth kinetics (lag phase, doubling time, maximum density)

    • Biofilm formation (attachment strength, architecture, dispersal dynamics)

    • Stress resistance (survival rates under various stressors)

    • Motility assays (swimming, swarming, twitching)

  • Statistical analysis framework:

    • Analysis of variance (ANOVA) for multiple condition comparisons

    • Post-hoc tests with appropriate correction for multiple comparisons

    • Non-parametric alternatives when assumptions are violated

    • Mixed-effects models for complex experimental designs

  • Phenotype-genotype correlation:

    • Sequence targeted mutations in the PFLU_5318 gene

    • Perform complementation assays with various constructs

    • Create domain-specific mutations to identify functional regions

For colony morphology analysis, researchers should document standardized observations including colony size, shape, margin characteristics, elevation, and pigmentation changes, following protocols similar to those used in P. fluorescens experimental evolution studies .

What bioinformatic approaches can predict the functional role of PFLU_5318 based on sequence data?

Bioinformatic analysis provides valuable insights into potential PFLU_5318 functions through comparative and predictive approaches:

  • Sequence-based analysis:

    • Homology searching using BLAST against diverse databases

    • Multiple sequence alignment of UPF0114 family members

    • Phylogenetic analysis to trace evolutionary relationships

    • Conservation mapping to identify functionally important residues

  • Structural prediction methods:

    • Secondary structure prediction (e.g., JPred, PSIPRED)

    • Transmembrane domain prediction (e.g., TMHMM, Phobius)

    • 3D structure modeling using homology or ab initio approaches

    • Protein disorder prediction for flexible regions

  • Functional annotation approaches:

    • Gene neighborhood analysis across Pseudomonas genomes

    • Co-expression network construction from transcriptomic data

    • Protein domain architecture comparison

    • Gene ontology term enrichment analysis

  • Integration with experimental data:

    • Incorporate phenotypic data from mutant studies

    • Map experimental interaction data onto predicted structures

    • Validate predictions through targeted experimental approaches

These computational predictions should serve as hypothesis generators for experimental validation rather than definitive functional assignments. The integration of multiple bioinformatic approaches with experimental data provides the most robust framework for functional prediction .

How can researchers integrate transcriptomic and proteomic data to understand PFLU_5318 function in cellular context?

Multi-omics data integration offers a powerful approach to understanding PFLU_5318 function within the cellular network:

  • Experimental design for multi-omics:

    • Coordinate sampling for different omics platforms

    • Include temporal dynamics (time course experiments)

    • Consider multiple environmental conditions

    • Compare wild-type vs. PFLU_5318 mutant strains

  • Data generation and quality control:

    • Transcriptomics: RNA-seq with appropriate sequencing depth

    • Proteomics: Shotgun or targeted approaches with quantitative accuracy

    • Metabolomics: Targeted analysis of relevant metabolic pathways

    • Phosphoproteomics: To identify signaling changes

  • Integrative analysis methodologies:

    • Correlation network analysis across omics layers

    • Pathway enrichment analysis with integrated data

    • Causal network inference to identify regulatory relationships

    • Machine learning approaches for pattern recognition

  • Visualization and interpretation:

    • Multi-omics data visualization tools

    • Pathway mapping of differential expression/abundance

    • Protein-protein interaction network visualization

    • Regulatory network reconstruction

This integrative approach can reveal whether PFLU_5318 functions primarily at the transcriptional, post-transcriptional, or post-translational level, and can identify the cellular processes most affected by PFLU_5318 perturbation. Such comprehensive analysis may reveal previously unrecognized functions of this UPF0114 family protein in Pseudomonas physiology and adaptation .

What are the most promising research directions for further characterizing PFLU_5318 function?

Based on current knowledge and methodological approaches, several high-priority research directions emerge for PFLU_5318 functional characterization:

  • Structure-function relationship studies:

    • Determination of three-dimensional structure through X-ray crystallography or cryo-EM

    • Mapping of functional domains through systematic mutagenesis

    • Investigation of potential ligand binding sites

    • Analysis of protein dynamics through hydrogen-deuterium exchange

  • Evolutionary and ecological context:

    • Comparative genomics across diverse Pseudomonas strains

    • Experimental evolution under various selective pressures

    • Natural population sampling to assess polymorphism

    • Host-microbe interaction studies for plant-associated strains

  • Systems biology approaches:

    • Construction of genome-scale models incorporating PFLU_5318

    • Network perturbation analysis following PFLU_5318 manipulation

    • Identification of genetic and physical interaction networks

    • Synthetic biology approaches to engineer novel functions

  • Translational research potential:

    • Assessment of PFLU_5318 as a target for antimicrobial development

    • Exploration of biotechnological applications based on function

    • Investigation of roles in plant growth promotion or biocontrol

These research directions leverage interdisciplinary approaches to comprehensively characterize PFLU_5318, moving beyond isolated experiments to understand its role in the broader context of bacterial physiology, ecology, and evolution.

How can researchers design collaborative studies to accelerate understanding of UPF0114 family proteins across bacterial species?

Collaborative research frameworks offer efficient approaches to characterize the UPF0114 protein family across diverse bacterial species:

  • Standardized methodological approach:

    • Development of shared protocols for genetic manipulation

    • Establishment of common phenotypic assay conditions

    • Agreement on standardized data reporting formats

    • Creation of centralized data repositories

  • Division of experimental focus:

    • Species-specific teams focusing on model organisms

    • Technology-focused groups developing specialized analytical methods

    • Computational teams for cross-species comparison and prediction

    • Integration specialists for multi-omics data analysis

  • Consortium structure and communication:

    • Regular virtual meetings for data sharing and discussion

    • Shared electronic lab notebooks for transparent methodology

    • Collaborative manuscript preparation with clear authorship guidelines

    • Open access data sharing prior to publication

  • Resources and technologies to be shared:

    • Strain collections with standardized mutations

    • Validated antibodies and other research reagents

    • Specialized equipment access through collaborative agreements

    • Computational pipelines and analysis tools

This collaborative framework accelerates scientific progress by reducing redundant efforts, enabling comparative analysis across species, and bringing diverse expertise to bear on the challenging problem of functionally characterizing UPF0114 family proteins like PFLU_5318.

What are the recommended protocols for genetic manipulation of PFLU_5318 in Pseudomonas fluorescens?

Genetic manipulation of PFLU_5318 in P. fluorescens requires specialized techniques optimized for this species:

  • Gene deletion methodology:

    • Homologous recombination-based approaches

    • Construction of suicide vectors containing flanking regions

    • Counter-selection strategies (e.g., sacB-based)

    • Verification by PCR, sequencing, and phenotypic testing

  • Complementation strategies:

    • Chromosomal integration at neutral sites

    • Use of native promoters for physiological expression levels

    • Inducible systems for controlled expression

    • Tagging approaches that maintain protein functionality

  • Reporter fusion construction:

    • Transcriptional fusions to monitor promoter activity

    • Translational fusions to track protein localization

    • Selection of appropriate reporters (fluorescent proteins, enzymatic reporters)

    • Validation of fusion protein functionality

  • Site-directed mutagenesis approaches:

    • Targeting of conserved residues identified bioinformatically

    • Alanine-scanning mutagenesis of transmembrane domains

    • Domain swapping with homologous proteins

    • Introduction of specific mutations identified in experimental evolution

Each genetic manipulation should be verified through multiple approaches, including molecular verification, expression analysis, and phenotypic characterization to ensure the observed effects are specifically attributable to the intended genetic changes.

What quality control measures should be implemented when working with recombinant PFLU_5318 protein?

Rigorous quality control is essential for ensuring reliable and reproducible results when working with recombinant PFLU_5318:

  • Protein identity verification:

    • Western blot analysis with anti-His antibodies

    • Mass spectrometry confirmation of intact mass

    • N-terminal sequencing to confirm sequence fidelity

    • Peptide mass fingerprinting after proteolytic digestion

  • Purity assessment methods:

    • SDS-PAGE with densitometry analysis (target >90% purity)

    • Size exclusion chromatography for aggregation analysis

    • Endotoxin testing for samples intended for biological assays

    • Host cell protein detection using sensitive methods

  • Functional validation:

    • Activity assays based on predicted function

    • Proper folding assessment through circular dichroism

    • Thermal stability analysis via differential scanning fluorimetry

    • Binding assays with predicted interaction partners

  • Batch-to-batch consistency measures:

    • Standardized production and purification protocols

    • Reference standard comparison for each new preparation

    • Long-term stability monitoring under storage conditions

    • Detailed record-keeping of all production parameters

Implementation of these quality control measures ensures that experimental results can be attributed to PFLU_5318 properties rather than to contaminants, degradation products, or improperly folded protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.