Recombinant Pseudomonas mendocina ATP synthase subunit a (atpB)

What is ATP synthase subunit a (atpB) in Pseudomonas mendocina and what is its biological role?

ATP synthase subunit a (atpB) in Pseudomonas mendocina is a membrane protein component of the F0 sector of ATP synthase. This protein (UniProt ID: A4Y193) spans 272 amino acids and plays a critical role in the proton channel formation necessary for ATP synthesis. The protein functions within the F0F1-ATP synthase complex, which is essential for energy production in bacterial cells. In P. mendocina, atpB forms part of the membrane-embedded portion that facilitates proton translocation across the membrane, which drives the catalytic synthesis of ATP in the F1 portion of the complex .

What is the amino acid sequence and predicted structural features of P. mendocina atpB?

The full amino acid sequence of P. mendocina ATP synthase subunit a (atpB) consists of 272 amino acids:

MADTPAEYIQHHLQNLVYGSHPEKGWIIAQTPEEVKAMGFWAVHVDTLGWSLFMGLIFITLFRMAAKKAVTGVPSGLQNMAEMCIEFVQGIVKDTFHGKNPLVAPLALTIFVWVFLMNSLKWIPVDYIPGLAHAMGLPYFKIVPTADPNGTFGISLGVFLLIIFYSIKVKGVGGFTKELSFTPFNHWALIPFNLFLEIIGLLTKPLSLALRLFGNMYAGEVVFILIALLPFYVQWGLNVPWAIFHILVIPLQAFIFMVLTVVYLSAAHEDHH

Structurally, bioinformatic analyses predict that atpB contains multiple transmembrane helices, consistent with its role in the membrane-embedded F0 portion of ATP synthase. The protein likely adopts a conformation that allows it to form part of the proton channel across the bacterial membrane, similar to other F0 subunits characterized in various bacterial species.

How is recombinant P. mendocina atpB typically expressed for research purposes?

Recombinant P. mendocina atpB is typically expressed in Escherichia coli expression systems. The commercially available recombinant protein features the full-length sequence (amino acids 1-272) fused to an N-terminal His tag to facilitate purification. The expression in E. coli allows for high protein yields and simplified purification procedures through affinity chromatography targeting the His tag. This approach has proven effective for producing sufficient quantities of the protein for structural and functional studies while maintaining the integrity of the protein's native conformation .

How does P. mendocina atpB compare structurally and functionally to homologous proteins in other Pseudomonas species?

Comparative analyses of ATP synthase subunit a across Pseudomonas species reveal important evolutionary relationships and functional conservation. While P. mendocina atpB shares significant sequence homology with its counterparts in other Pseudomonas species such as P. putida , there are notable species-specific variations that may reflect adaptation to different ecological niches.

What experimental approaches are recommended for studying membrane insertion and topology of P. mendocina atpB?

For investigating the membrane insertion and topology of P. mendocina atpB, several complementary experimental approaches are recommended:

• Site-directed fluorescence labeling with environment-sensitive probes - This approach, which has been successfully used for studying membrane proteins like PopD in P. aeruginosa , can reveal how specific segments of atpB interact with the membrane environment. By strategically introducing cysteine residues at different positions along the protein and labeling them with environment-sensitive fluorophores, researchers can determine which regions are embedded in the membrane, exposed to the aqueous environment, or involved in protein-protein interactions.

• Fluorescence dual-quenching assays - These can be employed to monitor conformational changes in atpB segments upon interaction with membrane components or other subunits of the ATP synthase complex. This technique has proven valuable for studying how proteins like PopD change their conformation in the presence of interacting partners .

• Proteolytic mapping combined with mass spectrometry - This approach can identify exposed regions of the protein, helping to establish the topology of atpB within the membrane.

• Cross-linking studies - Chemical cross-linking followed by mass spectrometric analysis can identify points of contact between atpB and other ATP synthase subunits, providing insights into the assembly and organization of the complex.

These methodologies, when used in combination, can provide a comprehensive understanding of how atpB integrates into membranes and contributes to ATP synthase function.

What are the implications of studying P. mendocina atpB for understanding bacterial energy metabolism and antibiotic resistance?

Studying P. mendocina atpB has significant implications for understanding both bacterial energy metabolism and potentially addressing antibiotic resistance:

• Energy metabolism insights: As a critical component of the ATP synthase complex, atpB plays a central role in energy production. Characterizing its structure-function relationship can reveal fundamental principles of bioenergetic coupling in bacteria. This is particularly relevant for understanding how Pseudomonas species adapt their energy metabolism to various environmental conditions.

• Novel antimicrobial targets: ATP synthase represents a promising target for antimicrobial development. While P. mendocina is rarely pathogenic , insights from studying its ATP synthase components could be applicable to more clinically relevant Pseudomonas species like P. aeruginosa, which shares similar ATP synthase architecture but presents significant therapeutic challenges due to intrinsic antibiotic resistance.

• Metabolic adaptation during infection: Recent studies on P. aeruginosa have highlighted the importance of metabolic genes for bacterial survival during host infection . Although focused on different proteins, these studies establish the principle that understanding bacterial energy metabolism components like atpB may reveal vulnerabilities that could be exploited during host-pathogen interactions.

• Cross-species comparisons: Comparative analyses of atpB across Pseudomonas species, including the occasionally pathogenic P. mendocina , may identify species-specific features that contribute to different pathogenic potentials and metabolic capabilities.

These research directions underscore the value of studying P. mendocina atpB beyond its basic biochemical characterization.

What are the optimal conditions for expression and purification of recombinant P. mendocina atpB?

Based on established protocols for membrane proteins and specific information about P. mendocina proteins, the following optimal conditions are recommended for expression and purification of recombinant atpB:

Expression System:

• E. coli is the preferred expression host, particularly BL21(DE3) strains optimized for membrane protein expression

• Expression vectors containing T7 promoters with tight regulation (such as pET series) are recommended

• Fusion with an N-terminal His tag facilitates purification while minimizing interference with membrane insertion

Expression Conditions:

• Induction with 0.5-1.0 mM IPTG at lower temperatures (16-25°C) for 16-20 hours often yields better results for membrane proteins

• Supplementation with glucose (0.5-1%) can help stabilize the expression

• Addition of membrane-stabilizing agents such as glycerol (5-10%) to the growth medium can improve yield

Purification Strategy:

• Cell lysis using mechanical disruption (French press or sonication) in buffer containing detergents suitable for membrane proteins (e.g., n-dodecyl-β-D-maltoside or CHAPS)

• Initial purification using Ni-NTA affinity chromatography targeting the His tag

• Further purification using size exclusion chromatography to remove aggregates

• Optional ion exchange chromatography step if higher purity is required

This methodology has been adapted from successful approaches used for other Pseudomonas membrane proteins and should provide high-quality recombinant P. mendocina atpB suitable for further studies.

How can the purity, stability, and functional integrity of recombinant P. mendocina atpB be assessed?

Multiple complementary techniques should be employed to assess the purity, stability, and functional integrity of recombinant P. mendocina atpB:

Purity Assessment:

• SDS-PAGE with Coomassie or silver staining - Should show >90% purity with a single dominant band at the expected molecular weight

• Western blotting using anti-His antibodies to confirm identity

• Mass spectrometry for accurate mass determination and potential identification of co-purifying contaminants

Stability Analysis:

• Thermal shift assays to determine protein stability under various buffer conditions

• Dynamic light scattering to monitor aggregation state

• Circular dichroism spectroscopy to assess secondary structure integrity and thermal stability

• Storage stability testing at different temperatures (-80°C, -20°C, 4°C) and in various buffer compositions

Functional Integrity:

• Reconstitution into liposomes to assess membrane insertion and orientation

• Proton translocation assays using pH-sensitive fluorescent dyes

• ATP synthesis measurement when combined with other ATP synthase components

• Binding assays with known interacting partners within the ATP synthase complex

These comprehensive assessments ensure that the recombinant protein maintains its native properties and is suitable for downstream applications in structural and functional studies.

What reconstitution methods are most effective for functional studies of P. mendocina atpB?

For functional studies of membrane proteins like P. mendocina atpB, appropriate reconstitution into membrane-mimetic systems is crucial. The following methods are recommended based on successful approaches with similar proteins:

Liposome Reconstitution:

• Preparation of liposomes using E. coli total lipid extract or defined mixtures (POPC:POPE:POPG at 7:2:1 ratio) to mimic bacterial membranes

• Detergent-mediated reconstitution using a controlled detergent removal method:

  • Mix purified atpB with detergent-solubilized lipids

  • Remove detergent gradually using Bio-Beads or dialysis

  • Monitor reconstitution efficiency by density gradient centrifugation

Nanodiscs Assembly:

• Reconstitution into nanodiscs using appropriate membrane scaffold proteins (MSP1D1 or MSP1E3D1)

• This method provides a defined, stable membrane environment and is particularly useful for structural studies

Proteoliposome Functional Assays:

• For proton translocation studies, reconstitute atpB with other F0 subunits

• For ATP synthesis studies, co-reconstitute complete F0F1 complex

• Use fluorescent probes (ACMA or pyranine) to monitor proton translocation

• Conduct ATP synthesis assays using luciferin-luciferase system

These reconstitution approaches provide complementary information about the membrane insertion, orientation, and functional properties of P. mendocina atpB in environments that mimic its native membrane context.

What techniques are available for studying protein-protein interactions between atpB and other ATP synthase subunits?

Several sophisticated techniques can be employed to study the protein-protein interactions between P. mendocina atpB and other ATP synthase subunits:

In vitro Interaction Studies:

• Chemical Cross-linking coupled with Mass Spectrometry (XL-MS) - This approach can identify specific contact points between atpB and other subunits by creating covalent links between closely positioned amino acids

• Surface Plasmon Resonance (SPR) - For quantitative measurement of binding affinities between atpB and potential interacting partners

• Isothermal Titration Calorimetry (ITC) - To determine thermodynamic parameters of protein-protein interactions

Fluorescence-based Approaches:

• Förster Resonance Energy Transfer (FRET) - By labeling atpB and potential partners with appropriate fluorophore pairs, interactions can be detected and monitored in real-time

• Fluorescence Correlation Spectroscopy (FCS) - For studying dynamics of protein complexes

• Site-directed fluorescence labeling - Similar to approaches used in studying PopB and PopD interactions in P. aeruginosa , this can reveal conformational changes upon complex formation

Structural Studies:

• Cryo-Electron Microscopy - For visualizing the assembled ATP synthase complex with near-atomic resolution

• Solid-state NMR - Particularly useful for membrane protein complexes

• Native Mass Spectrometry - To analyze intact protein complexes and determine subunit stoichiometry

These methods provide complementary information about the nature, specificity, and dynamics of interactions between atpB and other components of the ATP synthase complex, offering insights into the assembly and function of this essential energy-producing machinery.

How might research on P. mendocina atpB contribute to understanding mechanisms of action for existing or novel antimicrobials?

Research on P. mendocina atpB may provide valuable insights into antimicrobial mechanisms and development opportunities:

• Target validation: As a component of the essential ATP synthase complex, atpB represents a potential target for antimicrobial development. Characterizing its structure, function, and interactions can validate its suitability as a drug target.

• Species-specific vulnerability: Comparative analysis of atpB across Pseudomonas species may reveal structural or functional differences that could be exploited for species-selective antimicrobial development.

• Resistance mechanism insights: Understanding how mutations in atpB might affect binding of potential inhibitors could predict resistance mechanisms and guide development of more robust antimicrobial agents.

• Combination therapy strategies: Knowledge of energy metabolism dependencies in Pseudomonas species could inform rational combination therapy approaches that target complementary metabolic pathways.

• Repurposing opportunities: Existing drugs that target ATP synthase components in other organisms might be evaluated for activity against Pseudomonas atpB, potentially accelerating development timelines.

The observation that P. mendocina infections have been successfully treated with antibiotics like ceftazidime suggests that disrupting cellular processes dependent on ATP synthesis can be an effective therapeutic strategy, highlighting the potential significance of atpB-focused research.

What are the most promising avenues for future research on P. mendocina atpB?

Based on current knowledge gaps and technological capabilities, several promising research directions for P. mendocina atpB warrant exploration:

• High-resolution structural characterization: Determining the atomic structure of P. mendocina atpB through cryo-electron microscopy or X-ray crystallography would provide foundational insights into its function and potential for therapeutic targeting.

• In situ functional studies: Developing methods to monitor atpB function within living P. mendocina cells would bridge the gap between in vitro observations and physiological reality.

• Systems biology integration: Investigating how atpB function coordinates with broader metabolic networks through multi-omics approaches could reveal unexpected regulatory relationships.

• Comparative studies across clinical isolates: Examining atpB sequence and functional variations across environmental and clinical P. mendocina strains might identify adaptations associated with pathogenicity.

• Metabolic engineering applications: Exploring how modifications to atpB might enhance desirable metabolic capabilities of P. mendocina for biotechnological applications, building on methodologies established for gene manipulation in Pseudomonas species .

• Protein engineering for structural studies: Developing stabilized variants of atpB through protein engineering could facilitate structural studies of this challenging membrane protein.

These research directions would collectively advance understanding of this important component of bacterial energy metabolism while potentially yielding practical applications in medicine and biotechnology.

What methodological advances would most benefit research on P. mendocina atpB and related membrane proteins?

Several methodological advances would significantly accelerate research on P. mendocina atpB and similar membrane proteins:

• Improved membrane protein expression systems: Development of specialized expression hosts optimized for problematic membrane proteins could increase yields and maintain native folding.

• Advanced nanodiscs and membrane mimetics: Next-generation membrane mimetics that better replicate the native membrane environment would improve functional reconstitution success.

• In-cell structural biology techniques: Methods for determining protein structures within bacterial cells would eliminate artifacts associated with purification and reconstitution.

• Single-molecule functional assays: Techniques to monitor individual atpB molecules would reveal functional heterogeneity masked in ensemble measurements.

• Computational modeling advances: Improved algorithms for predicting membrane protein structures, dynamics, and interactions would accelerate hypothesis generation and testing.

• Gene editing optimization: Refinement of genetic manipulation techniques for Pseudomonas species, building on existing transposon mutagenesis approaches , would facilitate in vivo functional studies.

• Microfluidic platforms: Development of microfluidic systems for high-throughput screening of conditions affecting atpB stability and function would accelerate optimization of experimental conditions.

These methodological advances would collectively address the significant challenges associated with studying membrane proteins like atpB and accelerate progress in understanding this important class of proteins.