Recombinant Pseudomonas mendocina ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

ATP synthase subunit b (atpF) anchors the F0 sector to the F1 catalytic domain, enabling proton translocation and rotational coupling for ATP synthesis . In P. mendocina, ATP synthase activity is critical under both aerobic and anaerobic conditions:

  • Anaerobic Metabolism: ATP synthase facilitates energy recycling via organic acid excretion (e.g., lactate, acetate) under fermentative conditions, maintaining proton motive force (Δp) of -254 to -71 mV .

  • Subunit Interactions: AtpF associates with subunits a (atpB) and δ (atpH) to stabilize the transmembrane proton channel .

Biochemical Studies

  • Structural Analysis: The recombinant protein’s solubility and stability enable crystallographic studies of ATP synthase assembly .

  • Inhibitor Screening: While P. mendocina ATP synthase has not been directly targeted, studies on Pseudomonas aeruginosa ATP synthase inhibitors (e.g., C1/C2 quinoline derivatives) highlight subunit b’s potential as a drug target .

Metabolic Adaptations

  • Energy Regulation: Downregulation of ATP synthase genes (e.g., atpF, atpD) under UV-B stress in cyanobacteria (Synechocystis sp.) suggests conserved regulatory mechanisms .

Comparative Analysis with Other Subunits

SubunitGeneRoleUniProt ID
Subunit aatpBProton channel formationA4Y193
Subunit δatpHF1-F0 couplingA4Y190
Subunit βatpDCatalytic ATP synthesisA4Y187

Challenges and Future Directions

  • Antibiotic Development: Despite ATP synthase’s conserved role, P. mendocina atpF has not been evaluated against quinoline-based inhibitors active in other pathogens .

  • Structural Dynamics: Molecular dynamics simulations of recombinant atpF could elucidate its role in proton translocation and rotational mechanics.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpF; Pmen_4611; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Pseudomonas mendocina (strain ymp)
Target Names
atpF
Target Protein Sequence
MNINLTLFGQTIAFAIFVWFCMKFVWPPLTQAMQERQKKIAEGLDAAGRAERDLQLAQERAAQMLRETKEQAAEILDRANKTANAIVEEAKAQARSEGEKLIAGAKAEIDLEVNRAKDQLRAQVAALAVTGAEQILQSTVDGAAHNDLVAKLASQL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase generates ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases are composed of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism of the central stalk subunits.; This subunit forms part of the F(0) channel and the peripheral stalk, connecting F(1) to F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit b (atpF) in Pseudomonas mendocina?

ATP synthase subunit b (atpF) is a critical component of the F₀ sector of ATP synthase in Pseudomonas mendocina. While specific structural data for P. mendocina atpF is limited, it shares functional similarity with other bacterial ATP synthase b subunits. The b subunit typically forms a peripheral stalk that connects the membrane-embedded F₀ sector with the catalytic F₁ sector, providing structural stability during the rotational catalysis mechanism.

Research approaches for structural characterization include recombinant expression followed by crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy. These methods require purified protein in milligram quantities, which can be achieved through optimized expression systems similar to those used for other ATP synthase subunits .

How does the atpF gene differ from other ATP synthase genes in P. mendocina?

The ATP synthase complex in Pseudomonas species typically consists of multiple subunits encoded by genes in the atp operon. While the search results don't specifically detail the atpF gene, we can draw parallels from related research on ATP synthase components. The atpF gene encodes subunit b, which differs from other ATP synthase components like atpB (encoding subunit a) in terms of sequence, structure, and function.

The atpB gene from P. mendocina encodes a 272-amino acid protein that forms part of the membrane-embedded proton channel . In contrast, atpF typically encodes a more hydrophilic protein that extends from the membrane. Comparing sequence homology between different ATP synthase subunits and across species can provide insights into evolutionary conservation and functional importance of specific regions.

What expression systems are most suitable for recombinant production of P. mendocina atpF?

Based on successful approaches with other ATP synthase subunits, Escherichia coli expression systems are generally suitable for recombinant production of P. mendocina atpF. The choice of expression vector and strain depends on specific research requirements:

Expression SystemVector ExamplesAdvantagesLimitations
E. coli with T7 promoterpET series, pMAL-c2xHigh expression levels, inducible controlPotential inclusion body formation
E. coli with fusion tagspMAL-c2x (MBP tag), pET-32a(+) (Trx tag)Enhanced solubility, simplified purificationTag may affect protein function
E. coli with chaperonesCo-expression with pOFXT7KJE3Improved folding of difficult proteinsIncreased metabolic burden on cells

For membrane-associated proteins like ATP synthase subunits, expression as fusion proteins with solubility-enhancing tags such as maltose-binding protein (MBP) can significantly improve yields, as demonstrated for other ATP synthase components . Co-expression with chaperone proteins (DnaK, DnaJ, GrpE) may further enhance proper folding and solubility.

What is the optimal protocol for cloning and expressing the P. mendocina atpF gene?

A comprehensive protocol for cloning and expressing the P. mendocina atpF gene would involve:

  • Gene synthesis or PCR amplification: For novel genes, synthetic gene construction using overlapping oligonucleotides (as demonstrated for other ATP synthase subunits) offers precision and codon optimization .

  • Vector selection and construction: Inserting the atpF gene into appropriate expression vectors with compatible restriction sites is crucial. Based on successful approaches with other ATP synthase subunits, the following steps are recommended:

    a. Design PCR primers with appropriate restriction sites (e.g., NdeI at 5' end and XhoI at 3' end)
    b. Amplify the gene using high-fidelity polymerase
    c. Digest both the PCR product and vector with appropriate restriction enzymes
    d. Ligate the gene into the vector and transform into competent E. coli cells
    e. Confirm the construct by sequencing

  • Expression optimization: Test multiple expression conditions including:

    a. Different E. coli strains (e.g., T7 Express lysY/Iq)
    b. Various induction temperatures (16°C, 25°C, 37°C)
    c. Range of inducer concentrations (0.1-1.0 mM IPTG)
    d. Co-expression with chaperone proteins to enhance solubility

This systematic approach enables researchers to identify optimal conditions for high-yield, soluble expression of recombinant atpF protein.

How can researchers effectively purify recombinant P. mendocina atpF protein?

Purification of recombinant P. mendocina atpF requires a multi-step approach tailored to the protein's properties and expression system. Based on methodologies used for similar proteins, the following purification strategy is recommended:

  • Cell lysis: For membrane-associated proteins, gentle lysis methods using mild detergents or specialized extraction buffers are preferable to preserve native structure.

  • Affinity chromatography: If expressed with an affinity tag (His, MBP, etc.), use the corresponding affinity resin for initial purification. For His-tagged proteins, immobilized metal affinity chromatography (IMAC) with nickel or cobalt resins is effective .

  • Ion exchange chromatography: Further purification based on the protein's isoelectric point can remove remaining contaminants.

  • Size exclusion chromatography: Final polishing step to ensure homogeneity and remove aggregates.

Recommended buffer conditions (based on successful purification of related ATP synthase subunits):

Purification StepBuffer CompositionpHTemperature
Cell Lysis50 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, protease inhibitors7.5-8.04°C
IMAC50 mM Tris-HCl, 300 mM NaCl, 20-250 mM imidazole (gradient)8.04°C
Tag Cleavage (optional)50 mM Tris-HCl, 150 mM NaCl, specific protease7.54-25°C
Size Exclusion20 mM Tris-HCl, 100 mM NaCl, 5% glycerol7.54°C

For storage, addition of 6% trehalose and aliquoting to avoid freeze-thaw cycles is recommended, similar to protocols for other ATP synthase components .

How can researchers assess the structural integrity and functionality of purified recombinant atpF?

Assessing the structural integrity and functionality of purified recombinant atpF involves multiple complementary techniques:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure content

    • Thermal shift assays to evaluate protein stability

    • Dynamic light scattering (DLS) to confirm monodispersity

    • Limited proteolysis to probe folding quality

  • Functional analysis:

    • Binding assays with other ATP synthase subunits to confirm interaction capacity

    • Reconstitution experiments with other ATP synthase components to assess complex formation

    • ATP hydrolysis assays when incorporated into partial or complete ATP synthase complexes

What experimental approaches can determine the interaction between atpF and other ATP synthase subunits?

Understanding subunit interactions is crucial for elucidating ATP synthase assembly and function. Several methodologies can be employed:

  • Co-immunoprecipitation (Co-IP): Using antibodies against atpF or interaction partners to pull down protein complexes.

  • Surface plasmon resonance (SPR): Measuring real-time binding kinetics between immobilized atpF and other subunits.

  • Isothermal titration calorimetry (ITC): Quantifying thermodynamic parameters of binding interactions.

  • Cross-linking coupled with mass spectrometry: Identifying proximity relationships between subunits in the assembled complex.

  • Yeast two-hybrid or bacterial two-hybrid assays: Screening for potential protein-protein interactions in vivo.

TechniqueInformation ObtainedAdvantagesLimitations
Co-IPQualitative binding in near-native conditionsWorks with endogenous proteinsMay detect indirect interactions
SPRBinding constants (KD, kon, koff)Real-time, label-free detectionRequires protein immobilization
ITCThermodynamic parameters (ΔH, ΔS, ΔG)Solution-based, high precisionHigh protein consumption
Cross-linking MSSpatial proximity mapsWorks with assembled complexesDepends on reactive residue positioning
Two-hybrid assaysIn vivo interaction screeningHigh-throughput capabilityHigh false positive/negative rates

These approaches have been successfully applied to other ATP synthase components and can be adapted for studying atpF interactions .

How does the amino acid sequence of P. mendocina atpF influence its structure-function relationship?

While specific data on P. mendocina atpF is not provided in the search results, we can apply general principles of structure-function analysis to this protein:

  • Sequence analysis: Comparing atpF sequences across species can identify:

    • Highly conserved regions likely critical for function

    • Variable regions that may confer species-specific properties

    • Functional motifs and domains

  • Structural predictions: Using computational tools to predict:

    • Secondary structure elements (α-helices, β-sheets)

    • Transmembrane regions

    • Protein-protein interaction interfaces

  • Mutagenesis studies: Systematic mutation of conserved residues to determine their roles in:

    • Protein stability

    • Subunit interactions

    • ATP synthase assembly

    • ATP synthesis/hydrolysis activity

For context, the ATP synthase subunit a (atpB) from P. mendocina consists of 272 amino acids with a sequence that contains multiple transmembrane regions important for proton translocation . Similar detailed analysis of atpF can reveal its structural features and functional domains.

What are common challenges in recombinant expression of ATP synthase subunits and how can they be addressed?

Recombinant expression of ATP synthase subunits presents several challenges that researchers frequently encounter:

  • Low expression levels: ATP synthase subunits, particularly membrane-associated components, often express poorly in heterologous systems.

    Solution: Optimize codon usage for the expression host, employ strong inducible promoters, and test different E. coli strains. Research has shown that T7 Express lysY/Iq strains can improve expression of challenging proteins .

  • Protein insolubility: Formation of inclusion bodies is common with membrane proteins.

    Solution: Express as fusion proteins with solubility-enhancing tags like MBP. Evidence shows that MBP fusion significantly improved the solubility of other ATP synthase subunits that were otherwise insoluble .

  • Protein toxicity: Expression of foreign membrane proteins can disrupt host cell membrane integrity.

    Solution: Use tightly regulated expression systems, lower induction temperatures (16-25°C), and reduce inducer concentration. Co-expression with chaperones like DnaK, DnaJ, and GrpE has been shown to mitigate toxicity effects .

  • Improper folding: Membrane proteins often misfold in heterologous systems.

    Solution: Co-expression with molecular chaperones has proven effective for other ATP synthase components. The pOFXT7KJE3 plasmid expressing DnaK, DnaJ, and GrpE chaperones has been specifically successful in improving folding of challenging proteins .

How can researchers optimize the reconstitution of functional ATP synthase complexes using recombinant subunits?

Reconstitution of functional ATP synthase complexes from individual recombinant subunits is a sophisticated experimental approach that requires careful optimization:

  • Subunit preparation:

    • Ensure high purity (>95%) of each component

    • Verify proper folding using structural characterization methods

    • Maintain appropriate buffer conditions to preserve native-like conformations

  • Assembly conditions optimization:

    • Test various detergent types and concentrations for membrane protein stabilization

    • Optimize lipid composition for reconstitution into liposomes or nanodiscs

    • Evaluate different protein:lipid ratios to maximize functional complex formation

  • Functional validation:

    • Measure ATP synthesis/hydrolysis activities

    • Assess proton translocation using pH-sensitive dyes

    • Monitor complex assembly using analytical ultracentrifugation or native gel electrophoresis

A systematic approach testing different reconstitution methods is required, as demonstrated in studies with chloroplast ATP synthase subunits . These methods can be adapted for P. mendocina ATP synthase components including atpF.

How can single-molecule techniques be applied to study the role of atpF in ATP synthase mechanics?

Single-molecule techniques offer unprecedented insights into biomolecular machines like ATP synthase:

  • Single-molecule FRET (smFRET):

    • Strategic labeling of atpF and interacting subunits with donor/acceptor fluorophores

    • Real-time monitoring of conformational changes during catalysis

    • Determination of dynamic interactions within the ATP synthase complex

  • Optical tweezers:

    • Direct measurement of forces generated during ATP synthesis/hydrolysis

    • Quantification of mechanical coupling between F₀ and F₁ sectors

    • Evaluation of atpF's contribution to mechanical stability

  • High-speed atomic force microscopy (HS-AFM):

    • Visualization of ATP synthase structural dynamics at nanometer resolution

    • Monitoring of rotational movements in reconstituted complexes

    • Assessment of structural integrity with and without atpF

These approaches enable researchers to address previously inaccessible questions about the mechanical role of atpF in energy conversion and the structural stability of ATP synthase complexes during operation.

What are the implications of atpF modifications for synthetic biology and biotechnological applications?

Engineered modifications of atpF have significant potential for various applications:

  • Enhanced ATP production systems:

    • Engineering atpF variants with optimized stability or interaction properties

    • Creating chimeric proteins with subunits from thermophilic organisms for increased stability

    • Developing ATP synthase complexes with improved efficiency for bioenergy applications

  • Biosensors development:

    • Utilizing the sensitivity of ATP synthase to proton gradients for pH sensing

    • Developing ATP synthase-based systems for detecting membrane potential changes

    • Creating hybrid molecular devices incorporating atpF as a mechanical component

  • Drug discovery platforms:

    • Screening for compounds that modulate ATP synthase activity

    • Identifying inhibitors specific to bacterial ATP synthase as potential antimicrobials

    • Using structure-based design to target unique features of atpF for therapeutic development

The methodological approaches used for studying PHA synthases in P. mendocina can be adapted for engineering atpF, potentially enabling development of bioenergy systems with enhanced ATP production capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.