Recombinant Pseudomonas mendocina Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene and Protein Structure

  • Gene Locus: The cobS gene in P. mendocina is located at locus Pmen_1759 .

  • Protein Sequence: The full-length recombinant CobS protein comprises 243 amino acids (UniProt ID: A4XT57), with a predicted molecular weight consistent with its role as a cobalamin synthase .

  • Structural Features: The enzyme contains transmembrane domains, a hallmark of cobalamin synthases, which are critical for membrane association during cobalamin biosynthesis .

Recombinant Expression

  • Expression System: The recombinant protein is produced in Escherichia coli with a His-tag for purification .

  • Storage and Stability: Optimized storage conditions include Tris-based buffer with 50% glycerol at -20°C or -80°C, with recommended avoidance of repeated freeze-thaw cycles .

Table 1: Key Properties of Recombinant P. mendocina CobS

PropertyDetail
UniProt IDA4XT57
Gene LocusPmen_1759
Amino Acid Length243 residues
Expression Region1-243 (full-length)
TagHis-tag (position determined during production)

Biochemical Function

CobS catalyzes the attachment of the lower ligand (e.g., dimethylbenzimidazole) to adenosylcobinamide-GDP, forming adenosylcobalamin-5′-phosphate (AdoCbl-5′-P), a precursor to active vitamin B₁₂ . This reaction is ATP-dependent and occurs in the cytoplasmic membrane .

Key Substrates and Products

  • Substrates: Adenosylcobinamide-GDP, α-ribazole-5′-phosphate .

  • Product: Adenosylcobalamin-5′-phosphate .

Research Findings

In Vitro Synthesis of Cobalamin

  • Activity Validation: Heterologously expressed CobS from P. mendocina retains enzymatic activity, as demonstrated by its ability to synthesize AdoCbl-5′-P in vitro .

  • Functional Homology: Studies in Salmonella enterica show CobS homologs catalyze the same reaction with a specific activity of 8–22 nmol/min/mg protein .

Enzyme Kinetics and Mechanism

  • CobS operates as part of a membrane-associated complex, requiring interaction with other enzymes like CobT (ribosyltransferase) and CobC (phosphatase) for full cobalamin production .

  • Overexpression of CobS in E. coli leads to cellular toxicity due to proton motive force dissipation, highlighting the need for regulated expression .

Table 2: Enzymatic Activity of CobS Homologs

OrganismSpecific Activity (nmol/min/mg)Substrate Utilization
Salmonella enterica8–22AdoCbi-GDP + α-ribazole-5′-P
E. coli (overexpressed)Not quantifiedMembrane-associated synthesis

Applications and Implications

  • Biotechnological Use: Recombinant CobS is employed in enzyme-linked immunosorbent assays (ELISAs) for studying cobalamin biosynthesis pathways .

  • Metabolic Engineering: Insights into CobS function aid in engineering microbial strains for vitamin B₁₂ production .

Challenges in Recombinant Production

  • Toxicity: High-level expression of CobS in E. coli disrupts membrane potential, necessitating co-expression of stress-response proteins like PspA .

  • Purification Difficulties: Low solubility and yield complicate large-scale production, though affinity tagging partially mitigates this .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing it for your product.
Synonyms
cobS; Pmen_1759; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Pseudomonas mendocina (strain ymp)
Target Names
cobS
Target Protein Sequence
MIAPRIALQFLTRLPVSLPGMPTPEQIGRSLLWYPAVGLLLGLLLWLAHLLLGQTPDVLQ AAIILALWVGLSGGLHLDGLADTADAWVGGFGDPGRTLAIMKDPRSGPIAVVVLVLLLLL KFAALLSLLQAGQGIYLVLLPWLGRSLLPLLLATTPYVRAGGLGQALVDHLPRRQLPWVL GGHVAAMLLLGWGALIALATALALFVWLRRALMQRLGGTTGDTAGALLELAECAALLALA LSL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Pseudomonas mendocina* catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas mendocina Cobalamin synthase (cobS)?

Pseudomonas mendocina Cobalamin synthase (CobS) is a polytopic integral membrane protein that catalyzes the penultimate step in the biosynthesis of coenzyme B12 (adenosylcobamide). Specifically, it mediates the condensation of the activated corrin ring and lower ligand base, representing a critical convergence point of two pathways necessary for nucleotide loop assembly in the adenosylcobamide biosynthetic pathway . The enzyme is conserved among all cobamide-producing bacteria and archaea, suggesting its evolutionary importance. According to UniProt data, the P. mendocina CobS protein (accession number A4XT57) consists of 243 amino acids and functions as part of the "late steps" in the B12 biosynthetic pathway .

How does CobS function within the cobalamin biosynthetic pathway?

CobS functions within the "late steps" of the adenosylcobamide biosynthetic pathway, which are responsible for the assembly of the nucleotide loop. These steps are required during both de novo synthesis and precursor salvaging of vitamin B12. The process begins with the activation of the corrin ring and lower ligand base, followed by CobS-catalyzed condensation of these activated precursors to form adenosylcobamide phosphate . In the final step, adenosylcobamide phosphate (AdoCbl-P) is dephosphorylated by the CobC enzyme (EC 3.1.3.73) to yield adenosylcobamide (AdoCbl) .

What biological relevance does P. mendocina and its CobS enzyme have?

Pseudomonas mendocina is a Gram-negative, aerobic, rod-shaped bacterium belonging to the family Pseudomonadaceae. In natural environments, P. mendocina is commonly isolated from water and soil samples . While the bacterium rarely causes disease in humans, severe infections requiring hospitalization have been documented. As of 2019, only 14 cases of P. mendocina infections had been reported worldwide, with four presenting as meningitis and five as endocarditis . All documented cases were successfully treated with antibiotics.

The CobS enzyme itself is critical for the production of cobalamin (vitamin B12), which serves as an important cofactor in various metabolic processes. In marine environments, cobalamin influences microbial communities because it is required by most eukaryotic phytoplankton, and demand can often exceed supply . Understanding CobS function may contribute to broader knowledge of microbial interactions in various ecosystems.

What are optimal purification protocols for the membrane-bound CobS protein?

Purification of CobS has historically been challenging due to its transmembrane nature. Recent advancements have improved isolation protocols significantly. A breakthrough methodology reported for Salmonella Typhimurium CobS purification yields 96% homogeneous protein . This improved protocol involves:

  • Overexpression in an appropriate bacterial host system

  • Cell disruption under controlled conditions to maintain membrane integrity

  • Solubilization of membrane proteins using optimized detergent concentrations

  • Sequential chromatography techniques to achieve high purity

  • Storage in a stabilizing buffer system containing 50% glycerol

For optimal results with recombinant P. mendocina CobS, storage recommendations include:

  • Long-term storage at -20°C or -80°C

  • Avoiding repeated freeze-thaw cycles

  • Maintaining working aliquots at 4°C for up to one week

The purified protein can be reconstituted into liposomes to investigate the effect of the lipid bilayer on CobS function, which has proven valuable for understanding the enzyme's catalytic mechanism .

How can researchers evaluate CobS activity in vitro?

In vitro assessment of CobS activity can be performed using several complementary approaches:

  • Substrate binding analysis: Direct measurement of binding affinities between purified CobS and its substrates using techniques such as isothermal titration calorimetry, surface plasmon resonance, or fluorescence-based assays .

  • Liposome reconstitution assays: Incorporation of purified CobS into artificial lipid bilayers to evaluate the influence of the membrane environment on enzyme activity. This approach has demonstrated enhanced CobS activity compared to detergent-solubilized preparations .

  • Coupled enzyme assays: Monitoring the formation of adenosylcobamide phosphate using coupled enzymatic reactions and spectrophotometric detection.

  • LC-MS analysis: Quantifying reaction products and intermediates to determine reaction kinetics and efficiency.

For accurate activity measurements, researchers should consider:

  • Maintaining anaerobic conditions during the assay if oxygen sensitivity is a concern

  • The inclusion of appropriate cofactors and metal ions

  • pH and temperature optimization based on the organism's native environment

  • Detergent or lipid composition effects on the enzyme's conformation and activity

What critical residues and motifs are essential for CobS function?

Structure-function analyses have identified several key residues and motifs necessary for CobS catalytic activity. In vivo CobS variant analyses have proven valuable for identifying essential structural elements . Critical features include:

  • Conserved membrane-spanning domains: Essential for proper enzyme integration and orientation in the cell membrane

  • Substrate binding pockets: Specific residues involved in coordinating the activated corrin ring and lower ligand base

  • Catalytic residues: Amino acids directly involved in the condensation reaction mechanism

  • Protein-protein interaction motifs: Regions that facilitate association with other enzymes in the biosynthetic pathway

Site-directed mutagenesis studies of highly conserved residues across CobS homologs can reveal structure-function relationships. Comparative analysis of CobS sequences from various organisms may highlight evolutionarily conserved elements critical for function.

How do environmental conditions influence CobS expression and activity?

Environmental factors significantly impact CobS expression and activity, as demonstrated in studies with related cobalamin-producing organisms:

  • Temperature effects: In Synechococcus cultures, low temperature (17°C) was shown to decrease pseudocobalamin (a cobalamin analog) quota, which may indirectly reflect changes in cobalamin synthase activity .

  • Nutrient availability: Low N:P ratios can affect pseudocobalamin production, suggesting potential regulation of the cobalamin biosynthetic pathway by nutrient availability .

  • Growth phase influence: Both pseudocobalamin and methionine synthase (MetH, which uses cobalamin as a cofactor) quotas are influenced by growth phase (exponential vs. stationary) and culture methods (batch vs. semicontinuous) .

These findings from related systems suggest that CobS expression and activity may similarly be modulated by environmental parameters, which researchers should consider when designing experiments.

What is the relationship between CobS and other enzymes in the B12 biosynthetic pathway?

CobS functions as part of a proposed multienzyme complex associated with the cell membrane that catalyzes the late steps of cobamide biosynthesis . This complex likely includes:

  • CbiB: Involved in earlier steps of the pathway

  • CobU: Activates the corrin ring substrate

  • CobT: Activates the lower ligand base

  • CobS: Catalyzes the condensation reaction

  • CobC: Performs the final dephosphorylation step

Research methods to investigate these relationships include:

  • Co-immunoprecipitation studies

  • Bacterial two-hybrid screening

  • Cryo-electron microscopy of the membrane-associated complex

  • Metabolic flux analysis to identify rate-limiting steps

What expression systems are most suitable for recombinant CobS production?

Selection of an appropriate expression system is critical for successful recombinant CobS production:

  • Bacterial expression systems:

    • E. coli-based systems with specialized vectors containing suitable promoters and fusion tags

    • Host strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Codon-optimized synthetic genes to enhance expression efficiency

  • Expression conditions optimization:

    • Induction parameters (inducer concentration, temperature, duration)

    • Growth media composition

    • Co-expression with chaperones to assist proper folding

  • Fusion tags considerations:

    • The tag type should be determined during the production process based on protein behavior

    • Common options include His-tag, MBP, or SUMO fusions to enhance solubility and facilitate purification

  • Storage considerations:

    • Optimal buffer composition includes Tris-based buffer with 50% glycerol

    • Storage at -20°C or -80°C for extended periods

    • Avoidance of repeated freeze-thaw cycles

How can researchers investigate the membrane association of CobS?

The conserved membrane association of CobS across diverse bacteria and archaea suggests important functional significance. Researchers can investigate this association using:

  • Membrane fractionation techniques: Differential centrifugation and density gradient separation to isolate and characterize membrane-associated CobS.

  • Fluorescence microscopy approaches: Fusion of CobS with fluorescent proteins to visualize its cellular localization and dynamics.

  • Proteoliposome reconstitution: Incorporation of purified CobS into artificial membranes of varying lipid compositions to assess the influence of membrane properties on enzyme activity .

  • Lipid interaction studies: Analysis of specific lipid-protein interactions using techniques such as lipid overlay assays or mass spectrometry-based approaches.

  • Topological mapping: Determination of membrane-spanning regions and their orientation using techniques such as cysteine accessibility methods or proteolytic digestion coupled with mass spectrometry.

These approaches can help elucidate why the late steps of cobamide biosynthesis localize to cell membranes across diverse microbial species, addressing a significant knowledge gap in our understanding of coenzyme B12 biosynthesis .

What analytical methods are suitable for studying CobS-catalyzed reactions?

Several analytical approaches can be employed to study the CobS-catalyzed condensation reaction:

  • HPLC-based assays: High-performance liquid chromatography with appropriate detection methods (UV-Vis, fluorescence, or mass spectrometry) to separate and quantify reaction substrates, intermediates, and products.

  • Radioisotope incorporation: Tracking the incorporation of radiolabeled precursors into adenosylcobamide phosphate to monitor reaction progress.

  • Spectroscopic methods: UV-visible spectroscopy to monitor changes in the characteristic absorption spectrum of corrinoids during the reaction.

  • Mass spectrometry: Liquid chromatography-mass spectrometry (LC-MS) or matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) to identify and quantify reaction products with high sensitivity and specificity.

  • NMR spectroscopy: For structural characterization of reaction intermediates and products.

A complementary approach using multiple analytical methods provides the most comprehensive understanding of the reaction mechanism and kinetics.

What are the major challenges in CobS research?

Several significant challenges have historically impeded progress in CobS research:

  • Protein purification difficulties: As a polytopic membrane protein, CobS has been challenging to express, solubilize, and purify in sufficient quantities and purity for detailed biochemical characterization .

  • Assay development complexity: Developing reliable assays for CobS activity has been challenging due to the nature of the substrates and products involved.

  • Structural analysis limitations: Obtaining high-resolution structural information for membrane proteins like CobS requires specialized techniques and remains difficult.

  • Limited physiological understanding: The physiological relevance of the membrane association of CobS and other late-stage B12 biosynthetic enzymes remains poorly understood .

  • Interdisciplinary approach requirements: Comprehensive characterization of CobS function requires expertise in membrane protein biochemistry, enzymology, structural biology, and metabolic pathway analysis.

Addressing these challenges requires innovative methodological approaches and interdisciplinary collaboration.

How might CobS research contribute to broader scientific understanding?

Research on P. mendocina CobS has implications that extend beyond basic enzymology:

  • Evolutionary insights: Understanding why the membrane association of CobS is conserved across diverse microorganisms may reveal fundamental principles about the evolution of complex biosynthetic pathways .

  • Microbial ecology applications: Knowledge of cobalamin biosynthesis can inform studies of microbial communities where vitamin B12 availability influences population dynamics, such as marine ecosystems where eukaryotic phytoplankton require exogenous sources of this cofactor .

  • Biotechnological applications: Engineering CobS and related enzymes could potentially enhance vitamin B12 production or enable the biosynthesis of modified corrinoids with novel properties.

  • Medical relevance: Although P. mendocina rarely causes human infections, documented cases include serious conditions such as meningitis and endocarditis . Understanding its metabolic pathways may contribute to antimicrobial development.

  • Environmental bioremediation: Related Pseudomonas species have shown capabilities in bioremediation of compounds like metformin and guanylurea , suggesting potential biotechnological applications.

Continued investigation of CobS structure, function, and regulation will contribute to a more comprehensive understanding of vitamin B12 metabolism and its ecological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.