Recombinant Pseudomonas mendocina Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview and Biological Role

Lipoprotein signal peptidase II (LspA) is an aspartyl peptidase essential for processing bacterial lipoproteins. It cleaves the N-terminal signal peptide from prolipoproteins after their diacylglyceryl modification, enabling integration into the outer membrane or secretion . In P. mendocina, LspA is encoded by the lspA gene (locus tag: Pmen_0954), which shares conserved domains with homologs in other Gram-negative bacteria . Recombinant LspA refers to the enzyme produced via heterologous expression systems, such as Escherichia coli, for functional and structural studies .

Enzymatic Activity and Inhibition

  • Globomycin resistance assays: Recombinant P. mendocina LspA confers resistance to globomycin in E. coli, confirming its functional role as SPase II . Globomycin, a cyclic peptide antibiotic, inhibits LspA by binding irreversibly to the active site .

  • Kinetic studies: Transcription of lspA in related species (e.g., Rickettsia typhi) peaks during active growth phases, suggesting its role in virulence and proliferation .

Comparative Analysis

OrganismLspA FunctionKey Findings
P. mendocinaRecombinant SPase IIOverexpression in E. coli enhances globomycin resistance .
P. aeruginosaStructural homologCrystal structure with globomycin reveals aspartyl peptidase activity .
R. typhiVirulence-linked SPase IIComplements E. coli SPase II mutants, restoring lipoprotein processing .

Biotechnological Applications

Recombinant P. mendocina LspA is utilized in:

  1. Antibiotic development: Structural insights aid in designing globomycin analogs targeting multidrug-resistant pathogens .

  2. Protein engineering: Study of lipoprotein trafficking mechanisms in Gram-negative bacteria .

  3. Bioremediation tools: P. mendocina strains engineered for pollutant degradation may leverage LspA for efficient membrane protein assembly .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; Pmen_0954; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Pseudomonas mendocina (strain ymp)
Target Names
lspA
Target Protein Sequence
MPESSRFGHLPWLLLSVLILVADRVTKDIFEGTLSMYQRIEVIPGYFDWTLAYNTGAAFS FLADAAGWQRWFFAAIAIVVSVVLVVWLKRLKRHETLLAVALAMVLGGALGNLYDRVVLG HVVDFILVHWQSRWFFPAFNLADTFITIGAILLALDMFKSDKSAKEAAQ
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas mendocina Lipoprotein signal peptidase (LspA)?

Pseudomonas mendocina Lipoprotein signal peptidase (LspA) is an aspartyl protease enzyme that cleaves the transmembrane helix signal peptide of lipoproteins as part of the bacterial lipoprotein processing pathway. Like other LspA proteins, it plays a critical role in bacterial physiology and virulence. LspA represents an excellent target for antibiotic development as it is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria, with evidence suggesting a reduced likelihood of developing antibiotic resistance .

P. mendocina itself is an environmental bacterium that has been isolated from various sources including healthy mallard fecal samples and lettuce, and while generally non-pathogenic, it has been occasionally linked to endocarditis and sepsis in humans .

How does P. mendocina LspA function in the lipoprotein processing pathway?

P. mendocina LspA functions as a specialized protease within the lipoprotein processing pathway. After a lipoprotein precursor (prolipoprotein) is modified with a diacylglyceryl moiety, LspA specifically recognizes and cleaves its signal peptide at the periplasmic side of the bacterial membrane. This cleavage is essential for proper lipoprotein maturation and subsequent localization.

The enzyme's active site contains a catalytic dyad of aspartate residues that are highly conserved across bacterial species . Studies using molecular dynamics simulations and electron paramagnetic resonance reveal that LspA undergoes significant conformational changes during substrate binding and catalysis, with the periplasmic helix fluctuating on the nanosecond timescale to accommodate various substrate conformations .

What genomic characteristics of P. mendocina influence LspA expression?

P. mendocina exhibits a diverse phylogenetic relationship among its different strains, with whole genome analysis revealing two well-defined phylogenetic clusters . This genetic diversity may affect LspA expression levels and functional characteristics across different strains.

Genomic analysis of P. mendocina strains has shown that they typically lack antimicrobial resistance genes, which makes targeting pathway elements like LspA particularly promising for antibiotic development . The genomic context surrounding the LspA gene would likely influence its expression patterns, though strain-specific differences in gene regulation need to be considered when designing recombinant expression systems.

What expression systems are most effective for recombinant P. mendocina LspA production?

While the search results don't specifically address expression systems for P. mendocina LspA, insights can be drawn from general recombinant membrane protein methodologies. For membrane proteins like LspA, E. coli expression systems with specialized vectors containing strong, inducible promoters (T7, tac) are typically employed.

The hydrophobic nature of LspA presents challenges for expression, as improper folding can lead to inclusion body formation. Expression strains engineered to enhance membrane protein production (such as C41/C43 derivatives of BL21) may improve yields. Additionally, fusion partners like MBP (maltose-binding protein) or SUMO can enhance solubility and facilitate purification.

Codon optimization based on the P. mendocina genome sequence would likely be necessary to improve expression in heterologous hosts, considering the phylogenetic distinctiveness of P. mendocina strains identified through whole genome analysis .

What purification challenges are specific to recombinant P. mendocina LspA?

Purification of recombinant P. mendocina LspA presents several challenges common to membrane proteins:

  • Detergent selection: The choice of detergent is critical for maintaining LspA structure and function. Based on studies of other LspA proteins, detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) may be effective for extraction while preserving native conformational dynamics .

  • Conformational heterogeneity: The significant conformational dynamics of LspA, particularly the movement of the periplasmic helix, can result in structural heterogeneity that affects purification behavior . Multiple conformational states may exhibit different chromatographic properties.

  • Stability concerns: Maintaining stability throughout purification is challenging. Buffer optimization to include stabilizing lipids may help preserve the native conformation observed in molecular dynamics studies .

  • Activity preservation: Ensuring that the purified recombinant enzyme retains its catalytic activity is essential for downstream applications, requiring careful monitoring of the catalytic aspartate residues integrity throughout the purification process.

How do conformational dynamics influence P. mendocina LspA function?

The conformational dynamics of LspA play a crucial role in its function, with the periplasmic helix (PH) exhibiting significant flexibility on the nanosecond timescale. These dynamics facilitate an equilibrium of states that is essential for both substrate and antibiotic binding .

In the apo (unbound) state, LspA predominantly adopts a closed conformation where the PH occludes the charged active site residues from the lipid bilayer. This conformation prevents unfavorable interactions between polar catalytic residues and the hydrophobic membrane environment . The protein fluctuates between this closed state and a more open conformation required for substrate binding.

When bound to antibiotics like globomycin, LspA adopts multiple conformational states, with the dominant one being an intermediate open state. This conformational flexibility explains how LspA can accommodate and process diverse lipoprotein substrates despite having a relatively constrained active site .

The trigonal cavity formed in the most open conformation is the only state where a lipoprotein substrate could sterically fit in the correct orientation for signal peptide cleavage, highlighting the functional importance of these conformational changes .

What experimental approaches can characterize P. mendocina LspA structure-function relationships?

Several complementary experimental approaches can elucidate structure-function relationships in P. mendocina LspA:

  • Hybrid MD-EPR approach: Combining molecular dynamics (MD) simulations with electron paramagnetic resonance (EPR) spectroscopy has proven effective for characterizing LspA conformational dynamics . This hybrid approach can visualize and map conformational changes that would be difficult to capture with either technique alone.

  • Site-directed spin labeling: Strategic placement of spin labels at different positions in the LspA structure, particularly near the periplasmic helix and β-cradle, can provide detailed information about conformational changes during substrate binding and catalysis .

  • Continuous wave (CW) EPR: This technique can detect nanosecond timescale dynamics of specific regions in LspA, revealing the flexibility of domains involved in substrate recognition .

  • Double electron-electron resonance (DEER): DEER measurements can determine distance distributions between specific sites in different conformational states, providing insights into the range of conformations sampled by LspA .

  • Crystallography with substrate analogs: While challenging, crystallizing LspA with substrate analogs or inhibitors can provide atomic-level insights into binding interactions and conformational changes.

  • Mutagenesis of conserved residues: Systematic mutation of conserved residues, particularly the catalytic dyad and the 14 additional conserved residues surrounding the active site, can help define their roles in substrate recognition and catalysis .

How does antibiotic binding affect P. mendocina LspA structure and function?

Antibiotic binding to LspA induces significant changes in protein conformation and dynamics. With globomycin (an antibiotic that targets LspA) bound, the enzyme adopts multiple binding modes with the dominant conformation showing a more open state of the periplasmic helix compared to the apo form .

The antibiotic-bound state represents an intermediate conformation between the fully closed and fully open states. This intermediate conformation effectively inhibits both signal peptide cleavage and substrate binding by preventing the enzyme from adopting the fully open conformation required for substrate processing .

Interestingly, different antibiotics (such as globomycin and myxovirescin) can induce different conformational changes in LspA while maintaining similar interactions with the catalytic dyad residues . This suggests that the binding pocket exhibits substantial plasticity, which is relevant for the design of new LspA-targeting antibiotics.

The extensive conservation of residues in the LspA active site suggests that resistance mutations that would impede antibiotic binding would likely interfere with substrate binding and cleavage as well, making LspA a promising target for overcoming antibiotic resistance .

How can P. mendocina LspA be utilized as an antibiotic development target?

P. mendocina LspA represents a promising antibiotic target for several key reasons:

  • Essential enzyme: LspA is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria, making it a critical target for broad-spectrum antibiotics .

  • Resistance barrier: The highly conserved nature of the LspA active site creates a high barrier to resistance development. Mutations that would prevent antibiotic binding would likely also impair the enzyme's essential function .

  • Structural insights: The conformational dynamics of LspA, as revealed by molecular dynamics simulations and EPR studies, provide valuable information for structure-based drug design . Understanding how the periplasmic helix movement affects active site accessibility can guide the development of inhibitors that stabilize inactive conformations.

  • Multiple binding modes: The ability of LspA to accommodate different antibiotic orientations while maintaining key interactions with the catalytic residues suggests multiple avenues for inhibitor design .

  • Known inhibitors as templates: Existing LspA inhibitors like globomycin and myxovirescin, while not commercially viable, provide valuable templates for developing new antibiotics with improved properties .

The ideal antibiotic would likely stabilize LspA in a conformation that prevents substrate binding or catalysis, similar to how globomycin stabilizes an intermediate conformation that inhibits both signal peptide cleavage and substrate binding .

What is the relationship between P. mendocina virulence factors and LspA function?

P. mendocina possesses numerous virulence factors that could contribute to its occasional pathogenicity in humans, including a leukotoxin, flagella, pili, and Type 2 and Type 6 Secretion Systems . Many of these virulence factors are likely lipoproteins or depend on properly processed lipoproteins for their function.

LspA plays a crucial role in lipoprotein maturation, and disruption of its function would impair the proper localization and function of these virulence-associated lipoproteins. This relationship explains why LspA is important for virulence in various bacterial species, even though it is not directly classified as a virulence factor itself .

The proper processing of lipoproteins by LspA may be particularly important for the assembly and function of the Type 2 and Type 6 Secretion Systems identified in P. mendocina genomes . These secretion systems often require lipoproteins as structural components or for proper assembly.

Understanding this relationship could inform therapeutic strategies that target LspA to attenuate virulence without necessarily killing the bacteria, potentially reducing selective pressure for resistance development.

How can genetic manipulation systems be optimized for P. mendocina LspA studies?

Genetic manipulation of P. mendocina requires specialized tools adapted to its unique genetic characteristics. A system of genetic analysis for P. mendocina has been developed using a Tn10-containing variant of the pRK2013 plasmid (pRK2013-7) as a chromosome-mobilizing inheritable factor . This system allows for integration into the bacterial chromosome and transfer of genetic markers with varying frequencies (3.2 × 10⁻⁷ to 3.5 × 10⁻³), making it suitable for P. mendocina genetic mapping .

For LspA-specific studies, this system could be adapted to:

  • Create conditional knockdowns of LspA to study its essentiality in different growth conditions

  • Introduce site-directed mutations to study structure-function relationships

  • Insert reporter fusions to monitor LspA expression under different conditions

  • Engineer strains with tagged versions of LspA for purification and interaction studies

The genetic diversity observed among P. mendocina strains, with two well-defined phylogenetic clusters identified through whole genome analysis , suggests that genetic manipulation strategies may need to be optimized for specific strains. Consideration of strain-specific genomic contexts would be important for designing effective genetic tools.

How does P. mendocina LspA compare with homologs from other bacterial species?

P. mendocina LspA likely shares core structural and functional characteristics with homologs from other bacterial species, particularly within the Pseudomonas genus. While specific comparative data for P. mendocina LspA is not provided in the search results, general patterns can be inferred.

The catalytic dyad and the 14 additional highly conserved residues surrounding the active site are likely preserved in P. mendocina LspA, as these features are maintained across bacterial species due to their functional importance . The β-cradle and periplasmic helix structures that form the substrate "clamp" are also likely conserved.

Phylogenetic analysis of P. mendocina genomes has revealed two distinct clusters , suggesting potential variation in LspA sequences between different strains. The evolutionary relationships between different Pseudomonas species, with ANIb (Average Nucleotide Identity based on BLAST) values ranging from 74.76% to 77.82% between P. aeruginosa and other Pseudomonas species , indicate potential structural or functional differences in their LspA proteins.

These differences might influence substrate specificity, inhibitor sensitivity, or conformational dynamics, which would be important considerations for comparative studies and antibiotic development targeting LspA across different bacterial species.

What is the evolutionary significance of LspA conformational dynamics?

The conformational dynamics observed in LspA, particularly the flexibility of the periplasmic helix, have significant evolutionary implications:

  • Substrate adaptability: The nanosecond timescale fluctuations of the periplasmic helix allow LspA to accommodate and process a variety of lipoprotein substrates . This adaptability would be evolutionarily advantageous, enabling bacteria to process different lipoproteins without requiring specific LspA variants for each substrate.

  • Conservation of mechanism: The conservation of the conformational dynamics across bacterial species suggests that this flexibility is fundamental to LspA function rather than a species-specific adaptation .

  • Active site protection: The dominant closed conformation in the apo state, which occludes the charged active site from the lipid bilayer , represents an evolutionary solution to the challenge of placing polar catalytic residues within a hydrophobic membrane environment.

  • Resistance to inhibition: The conformational plasticity of LspA may have evolved in part as a mechanism to maintain function despite the presence of naturally occurring inhibitors in the environment, although this adaptability is now being targeted for antibiotic development .

Understanding these evolutionary aspects of LspA dynamics provides insights into bacterial adaptation mechanisms and can inform the development of inhibitors less susceptible to resistance development.

What membrane mimetics are optimal for in vitro studies of recombinant P. mendocina LspA?

The choice of membrane mimetic is crucial for maintaining the native structure and dynamics of membrane proteins like LspA in in vitro studies. Based on research with other LspA proteins, several approaches can be considered:

  • Detergent micelles: Detergents like DDM (n-dodecyl-β-D-maltoside) and LMNG (lauryl maltose neopentyl glycol) have been successfully used for extracting and studying membrane proteins while preserving native-like conformations .

  • Nanodiscs: Phospholipid bilayer discs stabilized by membrane scaffold proteins provide a more native-like environment than detergent micelles. They would be particularly valuable for studying the conformational dynamics of the periplasmic helix in a bilayer context .

  • Liposomes: Reconstitution into liposomes of defined lipid composition can be used for functional assays and to study how lipid environment affects LspA dynamics.

  • Bicelles: These disc-shaped lipid-detergent mixtures provide an environment closer to native membranes than pure detergent systems while maintaining sample homogeneity necessary for structural studies.

The choice of mimetic should consider that different membrane environments may influence the conformational equilibrium observed in the EPR and MD studies of LspA . For instance, the open conformation may be more or less populated depending on the properties of the membrane mimetic used.

How can molecular dynamics simulations be optimized for studying P. mendocina LspA?

Molecular dynamics (MD) simulations have proven valuable for studying LspA conformational dynamics , but require careful optimization for meaningful results:

  • Accurate force field selection: For membrane proteins like LspA, specialized force fields that accurately represent membrane-protein interactions, such as CHARMM36m with appropriate lipid parameters, are essential.

  • Adequate sampling: The nanosecond timescale dynamics of the periplasmic helix require sufficient simulation time to capture the range of conformational states. Enhanced sampling techniques like umbrella sampling or metadynamics may be necessary to observe rare conformational transitions .

  • Validation with experimental data: As demonstrated in the hybrid MD-EPR approach , simulations should be validated against experimental measurements such as EPR distance distributions or spin label mobility.

  • System composition considerations: The lipid composition of the simulated membrane should reflect the native environment of P. mendocina LspA, considering both headgroup and acyl chain diversity.

  • Inclusion of substrate models: Simulations including models of lipoprotein substrates can provide insights into binding mechanisms and induced conformational changes that are difficult to capture experimentally.

  • Analysis of water and ion dynamics: Special attention should be paid to water and ions around the active site, as they play crucial roles in the aspartyl protease mechanism of LspA.

This optimized MD approach would provide valuable insights into the functional dynamics of P. mendocina LspA that could inform both basic understanding and inhibitor design.

What high-throughput approaches can accelerate P. mendocina LspA inhibitor discovery?

Several high-throughput approaches can be employed to accelerate the discovery of P. mendocina LspA inhibitors:

  • Structure-based virtual screening: Using the conformational states identified through MD simulations and EPR studies , virtual screening can identify compounds predicted to bind and stabilize inactive LspA conformations.

  • Fragment-based drug discovery: Screening libraries of small chemical fragments that bind to different regions of LspA, particularly the active site and the periplasmic helix, followed by fragment linking or growing, can generate novel inhibitor scaffolds.

  • Fluorescence-based activity assays: Development of high-throughput assays using fluorogenic substrates based on natural LspA recognition sequences would enable rapid screening of compound libraries.

  • Thermal shift assays: Measuring changes in protein thermal stability upon compound binding can identify molecules that interact with LspA, even if they don't directly inhibit catalytic activity.

  • EPR-based screening: Given the importance of conformational dynamics in LspA function , EPR-based screening could identify compounds that alter these dynamics in ways that inhibit enzyme function.

  • Combination with genomic data: Integrating inhibitor screening with genomic information about P. mendocina virulence factors could help identify compounds that specifically target pathogenic strains while sparing commensal bacteria.

These approaches, especially when used in combination, could significantly accelerate the identification of novel LspA inhibitors with potential for development into new antibiotics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.