Recombinant Pseudomonas mendocina Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Respiration

This subunit is part of the Na(+)-translocating NADH-quinone reductase (Na(+)-NQR) complex, which couples electron transfer from NADH to quinone with sodium ion translocation. Key insights include:

  • Mechanism: Electrons from NADH reduce quinones, generating a sodium motive force used for ATP synthesis or nutrient uptake .

  • Homologous Systems: In Vibrio alginolyticus, the Na(+)-NQR complex comprises α, β, and γ subunits, with subunit E (analogous to P. mendocina’s subunit E) essential for structural stability and electron transfer .

  • Biotechnological Relevance: NADH dehydrogenases in Pseudomonas species influence redox metabolism and are engineering targets for optimizing cofactor supply in industrial biocatalysis .

Research Applications and Challenges

  • Enzyme Assays: Activity assays for similar enzymes face challenges due to quinones’ low solubility and NAD(P)H concentration limits .

  • Metabolic Engineering: In Pseudomonas taiwanensis, disrupting NADH dehydrogenases alters redox flexibility, highlighting the need to balance native enzyme activity with synthetic pathway demands .

  • Unresolved Questions:

    • Direct structural data for P. mendocina’s Na(+)-NQR remains limited.

    • Kinetics of sodium translocation efficiency in recombinant subunit E require further characterization .

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve subunit E’s role in the Na(+)-NQR complex.

  • Physiological Impact: Gene knockout studies to assess its necessity in P. mendocina’s respiratory chain.

  • Biotechnological Optimization: Leveraging its sodium-pumping activity for bioelectrochemical systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for the specific delivery time.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; Pmen_1599; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Pseudomonas mendocina (strain ymp)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVRAVFVENMALAFFLGMCTFIAISKKVETAIGLGVAVIVVLGITMPVNNLIY ANILKDGALAWAGLPEVDLSFLGLLTFIGVIAALVQILEMTLDKYVPSLYNALGVFLPLI TVNCAIMGGSLFMVERDYNLAESTVYGIGAGVSWALAIAALAGIREKLKYSDVPAGLQGL GITFITIGLMSLGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions. These reactions are coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas mendocina Na(+)-translocating NADH-quinone reductase subunit E?

The Na(+)-translocating NADH-quinone reductase subunit E (NqrE) is a critical membrane protein component of the respiratory Na+-NQR complex in Pseudomonas mendocina. It has a molecular weight of approximately 24 kDa and consists of 202 amino acids. The protein features a transmembrane structure that contributes to the ion translocation capabilities of the complete Na+-NQR complex. The amino acid sequence includes hydrophobic regions consistent with its membrane-spanning function: MEHYISLFVRAVFVENMALAFFLGMCTFIAISKKVETAIGLGVAVIVVLGITMPVNNLIYANILKDGALAWAGLPEVDLSFLGLLTFIGVIAALVQILEMTLDKYVPSLYNALGVFPLIITVNCAIMGGSLFMVERDYNLAESTVYGIGAGVSWALAIAALAGIREKLKYSDVPAGLQGLGITFITIGLMSLGFMSFSGVQL .

What primary functions does the Na+-NQR complex perform in bacterial metabolism?

The Na+-NQR complex performs a critical bioenergetic function by coupling NADH oxidation to Na+ ion translocation across the cytoplasmic membrane. This process generates a sodium gradient that drives various cellular processes, including nutrient uptake, motility, and antibiotic efflux. Structurally and mechanistically distinct from mitochondrial Complex I, Na+-NQR contains a unique set of cofactors including FAD, two covalently bound FMNs, riboflavin, and two iron-sulfur centers. The complex catalyzes the oxidation of NADH while pumping two Na+ ions across the membrane for each electron transfer cycle, establishing an electrochemical gradient that serves as a primary energy source for bacterial cells .

How are the subunits arranged in the Na+-NQR complex?

The Na+-NQR complex consists of six subunits designated NqrA through NqrF, arranged in a specific architecture that facilitates electron transfer and ion translocation. The NqrF subunit contains the active site for NADH oxidation and harbors an FAD cofactor and a [2Fe-2S] cluster. This subunit acts as a converter between the hydride donor NADH and subsequent one-electron reaction steps in the complex . The NqrE subunit, which spans the membrane multiple times, forms part of the ion translocation pathway. Collectively, these subunits create a machinery that shuttles electrons from NADH across the membrane twice to reduce quinone, while simultaneously pumping sodium ions outward. The conformational changes within the complex, particularly involving subunit NqrC, coordinate this electron transfer and ion translocation coupling mechanism .

What protocols are recommended for recombinant expression and purification of NqrE?

For successful recombinant expression of NqrE, researchers should consider the following methodological approach:

  • Expression System Selection: E. coli expression systems optimized for membrane proteins are recommended, though Vibrio cholerae expression hosts have also proven effective for Na+-NQR subunits .

  • Construct Design: The full gene sequence encoding NqrE should be cloned into an expression vector providing an N-terminal or C-terminal histidine tag for purification purposes. Expression region should span amino acids 1-202 for full functionality .

  • Culture Conditions: Growth at 28°C has been identified as optimal for Pseudomonas mendocina protein expression, with pH maintained at 7.4-7.8 .

  • Purification Strategy:

    • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA columns

    • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability

    • Storage recommendations: -20°C for regular use, -80°C for extended storage

    • Avoid repeated freeze-thaw cycles; maintain working aliquots at 4°C for up to one week

  • Quality Control: Verify purity by SDS-PAGE and confirm functionality through enzymatic assays measuring NADH oxidation rates.

What spectroscopic techniques are effective for studying the electron transfer properties of Na+-NQR?

Multiple complementary spectroscopic approaches can be employed to characterize electron transfer within the Na+-NQR complex:

  • UV-Visible Absorption Spectroscopy: Monitors the redox state of flavin cofactors, which typically exhibit absorption maxima around 450-455 nm. Changes in these spectra upon substrate addition provide insights into electron transfer pathways .

  • EPR Spectroscopy: Essential for characterizing the [2Fe-2S] clusters in Na+-NQR. This technique can detect the formation of flavosemiquinone intermediates and monitor the reduction state of iron-sulfur clusters during catalysis .

  • Circular Dichroism Spectroscopy: Provides information on the structural environment of the Fe-S clusters and can detect conformational changes associated with substrate binding and catalysis .

  • Stopped-Flow Kinetics: Allows measurement of rapid electron transfer rates by monitoring the spectral changes of cofactors in real-time following rapid mixing with substrates.

  • Fluorescence Spectroscopy: Useful for monitoring flavin cofactor environments and conformational changes during the catalytic cycle.

For the NqrF subunit specifically, these techniques have revealed that NADH addition leads to the formation of a neutral flavosemiquinone and partial reduction of the Fe-S cluster, establishing the electron transfer sequence as NADH → FAD → [2Fe-2S] .

How do the structural features of NqrE contribute to ion translocation?

The NqrE subunit plays a critical role in the Na+ translocation machinery of the Na+-NQR complex through several structural features:

  • Transmembrane Topology: NqrE contains multiple membrane-spanning helices that form part of the ion translocation pathway. These hydrophobic regions (such as "AIGLGVAVIVVLGITMPVNNLIY" and "GLGITFITIGLMSLGFMSFSGVQL") create channels that facilitate sodium ion movement across the membrane barrier .

  • Ion Coordination Sites: Specific residues within NqrE likely contribute to transient Na+ binding sites, though the precise coordination geometry remains an active area of investigation.

  • Conformational Flexibility: The protein undergoes structural changes during the catalytic cycle, which are essential for coupling electron transfer events to sodium pumping. These movements are orchestrated in concert with other subunits, particularly NqrC, which acts as an electron transfer switch .

  • Interface with NqrB: Recent structural studies suggest that NqrE interacts closely with NqrB, which contains a critical sodium binding site. The conformational changes in NqrE may influence the release of Na+ from this binding site in NqrB during the catalytic cycle .

  • Evolutionary Conservation: Sequence analysis of NqrE across different bacterial species reveals conserved motifs that likely represent functionally important regions involved in the ion translocation mechanism.

Research using site-directed mutagenesis targeting these conserved regions, coupled with functional assays measuring ion translocation efficiency, would provide valuable insights into the structure-function relationships of NqrE.

What is known about the catalytic mechanism of Na+-NQR and the role of NqrE?

The catalytic mechanism of Na+-NQR involves a sophisticated coupling of electron transfer to ion translocation. Based on recent structural and biochemical studies, the following model has emerged:

  • Initial Electron Entry: NADH binds to the NqrF subunit and transfers two electrons to its FAD cofactor, which subsequently passes electrons one at a time to the [2Fe-2S] cluster .

  • Electron Transfer Chain: From the iron-sulfur cluster, electrons are transferred to other redox centers in the complex, including the covalently bound FMNs in NqrB and NqrC, and eventually to quinone.

  • Conformational Switching: The redox state of a unique intramembranous [2Fe-2S] cluster orchestrates the movements of subunit NqrC, which acts as an electron transfer switch. This switching movement controls the release of Na+ from a binding site localized in subunit NqrB .

  • Ion Translocation Coupling: Large conformational changes in the complex, including movements in NqrE, couple the electron transfer events to the physical pumping of sodium ions across the membrane.

  • NqrE's Specific Role: While NqrE does not directly bind cofactors involved in electron transfer, it forms part of the ion conduction pathway and undergoes conformational changes essential for the ion pumping mechanism. Its multiple membrane-spanning segments likely create part of the channel through which Na+ ions are translocated .

The complete catalytic cycle involves the translocation of two Na+ ions per NADH oxidized, with electron transfer occurring twice across the membrane to the final quinone acceptor .

How does Na+-NQR from Pseudomonas mendocina compare with similar enzymes from other bacteria?

Comparative analysis of Na+-NQR across different bacterial species reveals important similarities and differences:

Bacterial SpeciesSubunit CompositionCofactor ContentKm for NADH (μM)Ion SpecificityNotable Features
P. mendocina6 subunits (NqrA-F)FAD, 2 FMNs, Riboflavin, 2 Fe-S centersNot specifically reportedNa+Contains NqrE with 202 amino acids
V. cholerae6 subunits (NqrA-F)FAD, 2 FMNs, Riboflavin, 2 Fe-S centersNot specifically reportedNa+Well-characterized system; structural data available
E. coli NDH-1Multiple subunitsFMN, Fe-S clusters14H+Prefers ferricyanide as electron acceptor
E. coli NDH-2Single subunitFADNot specifically reportedNone (non-pumping)Higher affinity for NADH; prefers coenzyme Q1
T. thermophilusNot specifically reportedNot specifically reported10Not specifically reportedSimilar Km value with NADH/coenzyme Q1 substrate pair
C. glutamicumNot specifically reportedNot specifically reportedNot specifically reportedNot specifically reportedHigher affinity and turnover rates for NADH using coenzyme Q1 compared with NADPH

Key differences include:

  • Structural Architecture: Na+-NQR has a unique six-subunit architecture distinct from the 14-subunit mitochondrial Complex I and the single-subunit bacterial NDH-2 enzymes.

  • Cofactor Composition: Na+-NQR contains a distinctive set of cofactors, including covalently bound FMNs and riboflavin, not typically found in other NADH:quinone oxidoreductases.

  • Ion Specificity: Unlike proton-pumping respiratory complexes, Na+-NQR specifically translocates sodium ions, making it particularly important in marine and pathogenic bacteria.

  • Catalytic Properties: The enzyme kinetics of Na+-NQR show substrate preferences and catalytic efficiencies that differ from other NADH:quinone oxidoreductases, with variations in Km values and turnover rates depending on the electron acceptor used .

What are the potential applications of NqrE research in developing new antimicrobials?

Research on NqrE has significant implications for antimicrobial development through several avenues:

  • Novel Antibiotic Target: Na+-NQR is widespread among pathogens including Vibrio cholerae and multidrug-resistant Pseudomonas and Klebsiella strains, yet absent in humans, making it an ideal selective target for antibiotics .

  • Structure-Based Drug Design: The structural characterization of NqrE and its interactions within the Na+-NQR complex provides a foundation for rational design of inhibitors that could disrupt ion translocation.

  • Metabolic Disruption: Inhibiting NqrE function would compromise the bacterial bioenergetic system, potentially leading to ATP depletion and cellular death, particularly in environments where Na+-NQR is the primary respiratory complex.

  • Resistance Mechanism Research: Understanding how structural variations in NqrE contribute to potential resistance mechanisms could inform the development of inhibitors less prone to resistance development.

  • Combination Therapy Approaches: Na+-NQR inhibitors could potentially sensitize resistant bacteria to existing antibiotics by compromising energy-dependent resistance mechanisms such as efflux pumps.

Methodological approaches to identify potential inhibitors include:

  • High-throughput screening assays measuring Na+-NQR activity

  • Fragment-based drug discovery targeting specific binding pockets in NqrE

  • In silico molecular docking studies to identify compounds that could disrupt critical NqrE interactions

  • Phenotypic screening to identify compounds that selectively affect bacteria reliant on Na+-NQR

What are the most effective methods for studying conformational changes in Na+-NQR during catalysis?

Investigating the dynamic conformational changes in Na+-NQR requires a multi-technique approach:

  • Cryo-Electron Microscopy (Cryo-EM): This technique has proven valuable for capturing different conformational states of Na+-NQR during its catalytic cycle. By preparing samples in various redox states and with different substrates, researchers have obtained structural snapshots representing different stages of the reaction .

  • Time-Resolved X-ray Crystallography: This approach can capture transient conformational states by initiating the reaction within crystals and collecting diffraction data at different time points.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique measures the exchange rates of backbone amide hydrogens with deuterium from the solvent, providing information about protein dynamics and conformational changes.

  • FRET (Förster Resonance Energy Transfer): By strategically placing fluorescent probes on different subunits of Na+-NQR, researchers can monitor distance changes between subunits during catalysis.

  • EPR Spectroscopy with Site-Directed Spin Labeling: This approach involves introducing spin labels at specific sites and measuring changes in their EPR spectra during catalysis, providing information about local conformational changes.

  • Molecular Dynamics Simulations: Computational approaches can complement experimental techniques by modeling the conformational changes of Na+-NQR based on available structural data and predicting the effects of mutations or ligand binding.

Research has shown that these conformational changes, particularly the movements of subunit NqrC acting as an electron transfer switch, are essential for coupling electron transfer to ion translocation .

How can kinetic parameters of NqrE be accurately determined in different experimental conditions?

Accurate determination of kinetic parameters for NqrE requires careful methodological considerations:

  • Enzyme Preparation:

    • Use purified recombinant NqrE with confirmed structural integrity

    • Ensure consistent buffer composition (typically 50 mM MOPS, pH 7.4) and temperature control (30°C is commonly used)

    • Verify protein concentration using validated methods like Bradford assay or UV absorbance

  • Assay Design:

    • Monitor NADH oxidation spectrophotometrically at 340 nm (ε₃₄₀=6.22 mM/cm)

    • Test multiple electron acceptors (e.g., coenzyme Q1, DCPIP, ferricyanide, 1,4-BQ)

    • Use substrate concentration ranges of 1.0-150 μM for NADH and 1.0 mM for electron acceptors

    • Include appropriate controls for spontaneous NADH oxidation

  • Data Analysis:

    • Use specialized software (e.g., SigmaPlot) for fitting kinetic data to appropriate models

    • Calculate Km and Vmax values using Lineweaver-Burk, Eadie-Hofstee, or non-linear regression methods

    • Report catalytic constants (kcat) and catalytic efficiency (kcat/Km)

  • Variable Conditions Testing:

    • Systematically vary pH (optimally 7.4-7.8 for Pseudomonas mendocina proteins)

    • Test temperature dependence (optimally around 28°C)

    • Evaluate effects of potential inhibitors or activators

    • Assess impact of metal ions (Ca²⁺, Cu²⁺, Fe³⁺, Mg²⁺, Pb²⁺, Zn²⁺, Mn²⁺)

  • Reporting Standards:

    • Include all experimental conditions in methodology sections

    • Report all kinetic parameters with appropriate error estimates

    • Present data in standardized formats (e.g., Michaelis-Menten plots)

For comparative purposes, researchers should note that Km values for NADH typically range from 17 to 258 μM depending on the electron acceptor used, with turnover rates (kcat) falling in the range of 4.95-19.8 min⁻¹ for similar NADH:quinone oxidoreductases .

What are the key unanswered questions about NqrE function that warrant further investigation?

Several critical aspects of NqrE function remain to be fully elucidated:

  • Precise Ion Translocation Pathway: While it's established that NqrE contributes to sodium translocation, the exact pathway and coordination sites for Na+ ions within the subunit structure remain unclear. Advanced molecular dynamics simulations coupled with site-directed mutagenesis could help map this pathway.

  • Conformational Coupling Mechanism: How conformational changes in NqrE are precisely coupled to electron transfer events in other subunits requires further investigation, potentially using time-resolved structural approaches.

  • Subunit Assembly Process: The biogenesis pathway for Na+-NQR, including how NqrE is inserted into the membrane and assembled with other subunits, represents an important area for future research.

  • Regulatory Mechanisms: Whether NqrE function is regulated by post-translational modifications or interactions with other cellular components remains largely unexplored.

  • Species-Specific Variations: Comparative analysis of NqrE across different bacterial species could reveal important adaptations related to different environmental niches or pathogenic lifestyles.

  • Alternative Functions: Beyond its role in respiration, whether NqrE or the Na+-NQR complex serves additional physiological functions in bacterial cells warrants investigation.

  • Inhibitor Binding Sites: Identification of specific binding pockets in NqrE that could be targeted by inhibitors represents a crucial direction for antimicrobial development.

Addressing these questions would significantly advance our understanding of bacterial bioenergetics and potentially lead to new therapeutic approaches targeting multidrug-resistant pathogens.

How might genetic engineering approaches be used to modify NqrE for enhanced functional studies?

Genetic engineering offers powerful approaches for studying and potentially enhancing NqrE function:

  • Site-Directed Mutagenesis Strategies:

    • Introduce cysteine residues at strategic positions for site-specific labeling with fluorescent or spin probes

    • Mutate predicted Na+ coordination residues to alter ion selectivity or affinity

    • Create chimeric proteins combining domains from NqrE homologs to investigate subunit-specific functions

    • Introduce histidine tags at different positions to facilitate various purification strategies

  • Protein Fusion Approaches:

    • Create NqrE fusion proteins with fluorescent reporters (e.g., GFP) for localization and expression studies

    • Develop split-protein complementation assays to study NqrE interactions with other subunits

    • Design domain-swapping experiments to identify critical functional regions

  • Expression Optimization:

    • Codon optimization for enhanced expression in model organisms

    • Design of soluble NqrE variants for easier biochemical characterization

    • Development of inducible expression systems for toxic variants

  • Directed Evolution Methods:

    • Error-prone PCR to generate NqrE variants with potentially enhanced stability or activity

    • Selection systems to identify variants with altered substrate specificity or inhibitor resistance

    • Compartmentalized self-replication to evolve NqrE variants with desired properties

  • CRISPR-Based Approaches:

    • Genome editing to create chromosomal mutations in native nqrE genes

    • CRISPRi systems for conditional knockdown studies

    • Base editing for precise modification of specific codons

These genetic engineering approaches would enhance our understanding of NqrE structure-function relationships and potentially lead to variants with improved properties for biotechnological applications or as tools for drug development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.