Recombinant Pseudomonas mendocina NADH-quinone oxidoreductase subunit A (nuoA)

What is the structural composition of Pseudomonas mendocina NADH-quinone oxidoreductase subunit A?

Pseudomonas mendocina NADH-quinone oxidoreductase subunit A (nuoA) is a membrane protein component of the NADH dehydrogenase complex (Complex I). The full-length protein consists of 137 amino acid residues with the sequence: MPDVPSTLSHDWAFAVFLLGVCGLIAFMLGVSSLLGSKAWGRSKNEPFESGMLPTGNARLRLSAKFYLVAMLFIFDVEALFLFAWAVSRESGWVGLVGATVFITILFAGLVYESAIGALDWAPEGRRKRQAKLKQ. The protein has transmembrane domains that anchor it within the bacterial cell membrane, consistent with its role in the respiratory chain .

What is the enzymatic classification of nuoA in P. mendocina?

Pseudomonas mendocina NADH-quinone oxidoreductase subunit A is classified with the Enzyme Commission (EC) number 1.6.99.5. It is also known by several alternative names including NADH dehydrogenase I subunit A, NDH-1 subunit A, and NUO1. The gene encoding this protein is designated as nuoA, with the ordered locus name Pmen_2412 in the Pseudomonas mendocina genome .

How should recombinant P. mendocina nuoA be stored for optimal stability?

For optimal stability of recombinant Pseudomonas mendocina NADH-quinone oxidoreductase subunit A, the protein should be stored in a Tris-based buffer with 50% glycerol. The recommended storage temperature is -20°C for regular use, while extended storage should be at -20°C or -80°C. It's important to note that repeated freezing and thawing cycles should be avoided to maintain protein integrity. For short-term work spanning up to one week, working aliquots can be maintained at 4°C .

What is the ecological niche of Pseudomonas mendocina and how might this relate to nuoA function?

Pseudomonas mendocina is a gram-negative bacterium that has been isolated from soil samples, particularly those enriched with ethanol as a carbon source. This ecological niche suggests adaptability to various carbon sources and environmental conditions . The NADH-quinone oxidoreductase complex, of which nuoA is a component, plays a crucial role in energy metabolism, enabling the bacterium to thrive in diverse environments. The protein's structure and function may be optimized for the specific metabolic challenges of soil environments, potentially including adaptations for varying oxygen levels or nutrient availability.

How does nuoA integrate within the larger NADH-quinone oxidoreductase complex?

The nuoA subunit serves as one of the membrane components of the NADH-quinone oxidoreductase complex (Complex I). Methodologically, to investigate this integration, researchers should consider:

• Protein-protein interaction studies: Employ co-immunoprecipitation or crosslinking experiments followed by mass spectrometry to identify direct interactions between nuoA and other complex components.

• Blue native PAGE analysis: This technique preserves protein-protein interactions during electrophoresis and can reveal the position of nuoA within the intact complex.

• Structural biology approaches: Cryo-electron microscopy of the purified complex can provide insights into the spatial arrangement of nuoA relative to other subunits.

• Mutagenesis studies: Systematic mutations of conserved residues in nuoA followed by assembly analysis can identify regions critical for complex formation.

The hydrophobic nature of nuoA, as evidenced by its amino acid sequence, suggests its involvement in membrane anchoring of the complex , which should be considered when designing experiments.

What methodologies are most effective for studying the expression patterns of nuoA under different environmental conditions?

To effectively study nuoA expression under varying environmental conditions, researchers should implement:

• Quantitative RT-PCR: This allows precise measurement of nuoA transcript levels when P. mendocina is exposed to different growth conditions. Similar methodologies have been successfully applied to study light-responsive gene expression in P. mendocina, where qRT-PCR confirmed RNA-seq findings .

• RNA-sequencing: For genome-wide expression analysis, RNA-seq can place nuoA expression in the context of global transcriptional changes. In P. mendocina studies, RNA-seq has been effective in identifying light-inducible genes with fold changes above 2.0 .

• Promoter-reporter fusions: Constructing fusions between the nuoA promoter and reporter genes (like GFP or luciferase) enables real-time monitoring of expression changes.

• 5′-RACE and CAGE experiments: These techniques precisely identify transcriptional start sites, which is critical for understanding promoter architecture and regulation. These methods have been successfully applied to characterize P. mendocina promoters like P6650 .

• DNase I footprint analysis: This can identify binding sites of transcriptional regulators on the nuoA promoter, as demonstrated for other P. mendocina genes .

What are the technical challenges in purifying functional recombinant nuoA protein and how can they be overcome?

Purifying functional membrane proteins like nuoA presents several challenges:

• Solubility issues: As a membrane protein, nuoA has hydrophobic domains that can cause aggregation. Researchers should:

  • Use mild detergents like DDM or LMNG for solubilization

  • Consider adding glycerol (40-50%) to stabilize the protein, as used in commercial preparations

  • Explore fusion tags that enhance solubility (e.g., MBP, SUMO)

• Expression optimization:

  • Expression in E. coli membrane protein-optimized strains (C41, C43)

  • Induction at lower temperatures (16-20°C) to slow folding and prevent inclusion body formation

  • Codon optimization for the expression system used

• Purification strategy:

  • Employ affinity chromatography with carefully positioned tags that don't interfere with protein folding

  • Consider tag removal with sequence-specific proteases, as demonstrated for other P. mendocina proteins

  • Implement size exclusion chromatography as a final polishing step in the presence of stabilizing detergents

• Functional verification:

  • Develop activity assays specific to nuoA's role in the NADH dehydrogenase complex

  • Use circular dichroism to confirm proper secondary structure formation

  • Employ thermal shift assays to identify buffer conditions that maximize stability

How can researchers investigate potential roles of nuoA in P. mendocina pathogenicity?

While Pseudomonas mendocina rarely causes disease in humans, there have been documented cases of infections, including bacteremia . To investigate potential roles of nuoA in pathogenicity:

• Comparative genomics approach:

  • Compare nuoA sequences from clinical isolates (like the bacteremia case) with environmental strains

  • Identify any variations that might correlate with virulence

• Gene knockout studies:

  • Generate nuoA deletion mutants and assess changes in:

    • Growth under conditions mimicking the human host

    • Biofilm formation capacity

    • Resistance to oxidative stress and antimicrobials

    • Virulence in appropriate infection models

• Transcriptional analysis:

  • Measure nuoA expression during infection-relevant conditions (e.g., serum exposure, macrophage interaction)

  • Identify co-regulated genes to place nuoA in pathogenicity networks

• Immune response studies:

  • Determine if purified nuoA elicits specific immune responses

  • Investigate if antibodies against nuoA provide protection in infection models

The rarity of P. mendocina infections (only 14 reported cases worldwide ) suggests low pathogenicity, but understanding nuoA's potential contribution could reveal unexpected virulence mechanisms.

What are the optimal conditions for heterologous expression of recombinant P. mendocina nuoA?

For optimal heterologous expression of recombinant P. mendocina nuoA, researchers should consider:

• Expression system selection:

  • E. coli strains specialized for membrane proteins (C41/C43)

  • Pseudomonas-based expression systems for native-like membrane environments

  • Cell-free systems for direct incorporation into nanodiscs or liposomes

• Vector design:

  • Incorporate a removable affinity tag (His, GST, etc.)

  • Include a fusion partner to enhance solubility if needed

  • Use inducible promoters with tight regulation (T7, araBAD)

• Culture conditions:

  • Lower induction temperatures (16-20°C)

  • Extended expression periods (16-24 hours)

  • Supplementation with specific membrane components if necessary

• Induction protocol:

  • Induce at mid-log phase (OD600 0.6-0.8)

  • Use lower inducer concentrations to prevent aggregation

  • Consider auto-induction media for gradual protein production

• Harvest and initial processing:

  • Gentle cell lysis methods to preserve membrane integrity

  • Immediate addition of protease inhibitors

  • Careful membrane fraction isolation using differential centrifugation

These recommendations draw from successful approaches used with other Pseudomonas membrane proteins, where soluble and active recombinant proteins were obtained through careful optimization .

What analytical techniques are most informative for characterizing nuoA structure and function?

To comprehensively characterize P. mendocina nuoA structure and function:

How can researchers effectively investigate potential interactions between nuoA and other proteins in the P. mendocina respiratory chain?

To effectively investigate protein-protein interactions involving nuoA:

• Cross-linking coupled with mass spectrometry:

  • Use membrane-permeable cross-linkers to capture transient interactions

  • Analyze cross-linked peptides by LC-MS/MS to identify interaction interfaces

  • Apply data analysis algorithms specifically designed for cross-linking data

• Co-immunoprecipitation with specific antibodies:

  • Generate antibodies against nuoA or use tagged versions

  • Perform pull-downs under native conditions

  • Identify interaction partners by mass spectrometry

• Bacterial two-hybrid systems:

  • Adapt membrane two-hybrid approaches for nuoA

  • Screen genomic libraries to identify novel interaction partners

  • Validate interactions with independent methods

• Förster resonance energy transfer (FRET):

  • Create fluorescent protein fusions with nuoA and potential partners

  • Measure energy transfer to confirm proximity in living cells

  • Use acceptor photobleaching to quantify interaction strength

• Blue native PAGE analysis:

  • Separate native complexes containing nuoA

  • Perform second-dimension SDS-PAGE to identify components

  • Compare complex formation under different conditions

These approaches can be complemented by computational prediction of protein-protein interactions based on structural models and sequence conservation patterns.

How might nuoA be involved in the light-responsive regulatory networks in P. mendocina?

Interestingly, Pseudomonas mendocina contains light-responsive regulatory systems, including the PmlR2 and PmSB-LOV proteins that form a blue light-sensitive regulatory system . While direct evidence linking nuoA to these photoreceptor systems is not established, several research approaches could explore potential connections:

• Transcriptional response analysis:

  • Determine if nuoA expression changes under different light conditions

  • Compare with known light-regulated genes in the P. mendocina genome

  • Use RNA-seq and qRT-PCR methodologies similar to those that identified other light-responsive genes

• Promoter analysis:

  • Examine the nuoA promoter region for binding sites of light-responsive transcription factors

  • Perform DNA-binding assays (such as gel-shift and DNase I footprint analysis) with purified light-responsive regulators like PmlR2

• Metabolic impact assessment:

  • Investigate whether light-induced changes in bacterial metabolism affect electron transport chain components

  • Measure NADH dehydrogenase activity under different light conditions

• Protein-protein interaction studies:

  • Explore potential physical interactions between nuoA and components of light-sensing pathways

  • Use methodologies such as co-immunoprecipitation or bacterial two-hybrid systems

The connection between respiratory chain components and light sensing could reveal novel regulatory mechanisms in bacterial energy metabolism.

What is the potential for nuoA as a target for antimicrobial development against rare Pseudomonas infections?

While Pseudomonas mendocina infections are rare, with only 14 reported cases worldwide , the development of targeted antimicrobials could be valuable for treating severe cases such as bacteremia or endocarditis. Research approaches in this direction could include:

• Target validation studies:

  • Generate nuoA knockout or knockdown strains and assess viability

  • Determine if nuoA is essential under conditions mimicking infection sites

  • Compare impact of nuoA inhibition across different Pseudomonas species

• Structure-based drug design:

  • Solve the structure of nuoA using cryo-EM or crystallography

  • Identify potential binding pockets for small molecule inhibitors

  • Perform in silico screening of compound libraries

• Functional assays for drug screening:

  • Develop high-throughput assays measuring nuoA activity

  • Screen for compounds that specifically inhibit nuoA function

  • Validate hits with secondary assays and structure-activity relationship studies

• Resistance development assessment:

  • Evaluate the likelihood of resistance development through mutation

  • Identify potential compensatory mechanisms in P. mendocina

  • Design inhibitor combinations to minimize resistance potential

Current treatment of P. mendocina infections relies on anti-pseudomonal antibiotics such as ceftazidime , but targeted approaches could enhance efficacy and reduce broad-spectrum antibiotic use.

What are common challenges in generating antibodies against nuoA and how can they be overcome?

Generating specific antibodies against membrane proteins like nuoA presents several challenges:

• Antigen preparation challenges and solutions:

  • Difficulty obtaining sufficient pure protein → Use synthetic peptides corresponding to exposed regions of nuoA

  • Potential conformational epitope loss → Consider using whole membrane preparations or detergent-solubilized protein

  • Protein instability → Stabilize with appropriate detergents or reconstitute in nanodiscs

• Immunization strategies:

  • Poor immunogenicity → Use carrier proteins (KLH, BSA) and stronger adjuvants

  • Toxicity to host animals → Employ stepped immunization protocols with gradual dose increases

  • Cross-reactivity concerns → Select peptide sequences unique to P. mendocina nuoA

• Antibody screening and validation:

  • Develop appropriate screening assays using recombinant nuoA protein

  • Validate specificity using nuoA knockout strains as negative controls

  • Perform Western blots on both denatured and native samples to assess epitope recognition

• Alternative approaches:

  • Consider phage display technology for antibody development

  • Explore nanobody/VHH antibody fragments which may access hidden epitopes

  • Use genetic approaches to introduce epitope tags into the nuoA gene in P. mendocina

What considerations are important when designing site-directed mutagenesis studies of nuoA?

When designing site-directed mutagenesis studies of nuoA, researchers should consider: