Recombinant Pseudomonas mendocina NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Production

Recombinant nuoK is a 102-amino acid protein (UniProt ID: A4XV11) expressed in E. coli with an N-terminal His-tag for purification . Key characteristics include:

PropertyDetails
Gene NamenuoK (synonyms: Pmen_2421, NADH dehydrogenase I subunit K)
Protein LengthFull-length (1-102 residues)
Molecular Weight~11 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol

Functional Role in Bacterial Metabolism

nuoK is a subunit of NADH-quinone oxidoreductase (Complex I), which catalyzes electron transfer from NADH to quinones, contributing to the proton gradient across the bacterial membrane . Key functional insights:

  • Electron Transport: Facilitates NADH oxidation and quinone reduction (NADH+H++QNAD++QH2\text{NADH} + \text{H}^+ + \text{Q} \rightarrow \text{NAD}^+ + \text{QH}_2) .

  • Genomic Context: Located in the nuo operon of P. mendocina NK-01, which also encodes other subunits of Complex I (e.g., nuoA, nuoB) .

  • Physiological Relevance: Critical for energy production under aerobic conditions and stress responses linked to quinone detoxification .

Amino Acid Sequence

The primary sequence of nuoK is:
MTGIPMEHGLALAAALFCIGLVGLMVRRNILFILMSLEVMMNAAALAFVVAGARWGQPDGQVMFIMVITLAAAEASIGLAILLQLYRRFNTLDIDAASEMRG .

Research Applications

Recombinant nuoK is widely used in:

  1. Enzyme Kinetics: Studying quinone reduction mechanisms and inhibitor screening (e.g., rotenone analogs) .

  2. Structural Biology: Crystallization trials to resolve Complex I architecture .

  3. Biotechnological Studies: Investigating bacterial respiratory adaptations in polyhydroxyalkanoate (PHA) synthesis pathways .

Comparative Analysis with Homologs

nuoK shares functional homology with subunits in other Pseudomonas species and pathogens like Mycobacterium bovis . Key distinctions include:

SpeciesGene LocusProtein LengthUniProt ID
P. mendocinaPmen_2421102 aaA4XV11
M. bovisBCG_317899 aaA1KNF1
P. aeruginosaMultiple lociVariableQ9I6T9

Technical Considerations for Experimental Use

  • Activity Assays: Requires reconstitution in lipid bilayers or detergent micelles to mimic native membrane environments .

  • Inhibition Studies: Sensitive to diphenyleneiodonium (DPI) and other Complex I inhibitors .

  • Commercial Availability: Sold as lyophilized powder (e.g., Creative BioMart, Labprice) for ELISA and biochemical assays .

Genomic and Evolutionary Insights

The nuoK gene in P. mendocina NK-01 is part of a 5.4-Mbp circular chromosome (62.51% GC content), distinct from the P. mendocina ymp strain (5.07 Mbp, 64% GC) . Evolutionary conservation of nuoK across bacteria underscores its essential role in aerobic respiration .

Future Research Directions

  • Mechanistic Studies: Elucidate proton translocation mechanisms in P. mendocina Complex I.

  • Biotechnological Engineering: Optimize nuoK for bioenergy applications (e.g., microbial fuel cells) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Pmen_2421; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Pseudomonas mendocina (strain ymp)
Target Names
nuoK
Target Protein Sequence
MTGIPMEHGLALAAALFCIGLVGLMVRRNILFILMSLEVMMNAAALAFVVAGARWGQPDG QVMFIMVITLAAAEASIGLAILLQLYRRFNTLDIDAASEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this species, ubiquinone is believed to be the primary electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase in bacterial metabolism?

NADH-quinone oxidoreductase plays a critical role in bacterial energy metabolism by catalyzing the transfer of electrons from NADH to quinones in the respiratory chain. This process is fundamental to cellular respiration and ATP generation. In Pseudomonas species, the NADH dehydrogenase complex (which includes the nuoK subunit) participates in:

  • Electron transport chain functionality

  • Energy conservation through proton translocation

  • Redox balance maintenance within the cell

  • Adaptation to different environmental conditions

These enzymes are particularly important for bacterial survival under various growth conditions, contributing to their metabolic versatility .

How does nuoK differ from other subunits in the NADH-quinone oxidoreductase complex?

The NADH-quinone oxidoreductase complex contains multiple subunits (designated as nuoA through nuoN in Pseudomonas species), each with specific functions:

SubunitPrimary FunctionApproximate SizeNotable Features
nuoKMembrane anchor, proton channel component~102 aaHighly hydrophobic, contains transmembrane helices
nuoJMembrane anchor, proton channel componentVariableWorks in conjunction with nuoK
nuoBElectron transferVariableContains iron-sulfur clusters

The nuoK subunit is primarily involved in the membrane-embedded portion of the complex, contributing to proton translocation across the membrane rather than direct electron transfer .

What are the optimal storage conditions for recombinant Pseudomonas mendocina nuoK protein?

For optimal preservation of recombinant Pseudomonas mendocina nuoK protein activity and stability, the following storage protocol is recommended:

  • Short-term storage (up to one week): Store working aliquots at 4°C

  • Medium-term storage: Store at -20°C in buffer containing 50% glycerol

  • Long-term storage: Store at -80°C in Tris-based buffer with 50% glycerol

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity

The addition of glycerol is critical as it prevents the formation of ice crystals that can denature the protein during freeze-thaw cycles. For experimental preparations, it is advisable to prepare small working aliquots to minimize degradation from repeated thawing .

What expression systems are most effective for producing recombinant nuoK protein?

The optimal expression system for recombinant nuoK protein production depends on experimental requirements and research goals:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliFast growth, simple genetics, economicalMay lack proper post-translational modificationsModerate to high
YeastEukaryotic post-translational modificationsLonger growth time than bacteriaModerate
BaculovirusHigh-level expression of membrane proteinsComplex system, expensiveHigh
Mammalian cellsNative-like protein folding and modificationsMost complex and expensiveLow to moderate

For membrane proteins like nuoK, E. coli or baculovirus expression systems are commonly employed, with the choice depending on whether native folding or high yield is prioritized . The host organism selection should be determined based on the specific experimental requirements and downstream applications.

How should researchers address contradictory data when studying nuoK function?

When encountering contradictory data in nuoK functional studies, researchers should follow a systematic approach:

  • Examine the data thoroughly - Identify specific discrepancies between expected and observed results. For membrane proteins like nuoK, inconsistencies often relate to purification conditions affecting protein conformation .

  • Evaluate initial assumptions - Re-evaluate the hypothesis about nuoK function. Consider whether the protein might have different roles under varying experimental conditions .

  • Consider alternative explanations - For nuoK specifically, contradictory results might arise from:

    • Different lipid environments affecting protein conformation

    • Varying redox states altering activity

    • Presence/absence of other subunits affecting function

    • Differences in detergent types used during purification

  • Modify experimental approaches - Implement alternative methods to validate findings:

    MethodApplication for nuoK ResearchData Output
    Enzyme activity assaysMeasure quinone reduction ratesQuantitative kinetic parameters
    Protein-protein interaction studiesIdentify interactions with other Nuo subunitsBinding affinities, complex formation
    MutagenesisDetermine essential residues for functionStructure-function relationships
  • Integrate mixed methods data - Combine different data types (structural, biochemical, genetic) to develop a more comprehensive understanding of nuoK function .

Contradictory results should be viewed as opportunities for discovery rather than experimental failures, as they may reveal novel aspects of nuoK function or regulation .

What analytical methods are most appropriate for studying nuoK enzyme kinetics?

The study of nuoK enzyme kinetics requires specialized approaches due to its membrane-bound nature and participation in a multi-subunit complex:

For comprehensive kinetic analysis, researchers should combine multiple approaches while considering that nuoK functions as part of a larger complex and may not show independent catalytic activity .

How can researchers differentiate between the roles of nuoK and other NADH-quinone oxidoreductase components in electron transport?

Differentiating the specific contributions of nuoK from other NADH-quinone oxidoreductase components requires sophisticated experimental approaches:

  • Site-directed mutagenesis - Introducing specific mutations in conserved residues of nuoK can identify amino acids critical for proton translocation without affecting electron transfer mediated by other subunits.

  • Subunit-selective inhibition - Some inhibitors may preferentially affect membrane-embedded subunits like nuoK versus peripheral components:

    Inhibitor TypePrimary TargetEffect on nuoK
    RotenoneNADH binding siteIndirect inhibition
    Piericidin AQuinone binding siteIndirect inhibition
    Hydrophobic uncouplersProton channelsDirect disruption of nuoK function
  • Complementation studies - Express wild-type or mutant nuoK in knockout strains to assess restoration of specific functions .

  • Cryo-EM or X-ray crystallography - Structural studies can reveal the spatial arrangement of nuoK relative to other subunits and help identify functional interfaces .

By combining these approaches, researchers can build a comprehensive understanding of nuoK's specific role within the larger NADH-quinone oxidoreductase complex.

What are the implications of nuoK structural variations between different Pseudomonas species?

The structural variations in nuoK between different Pseudomonas species have significant implications for bacterial physiology and potential biotechnological applications:

  • Adaptation to ecological niches - Variations in nuoK structure may reflect adaptations to different environmental conditions where various Pseudomonas species thrive. For example, P. mendocina (primarily found in soil and water) may have nuoK adaptations distinct from P. aeruginosa (frequently associated with clinical infections) .

  • Substrate specificity differences - Structural variations can lead to different quinone preferences:

    Pseudomonas SpeciesPrimary Quinone PreferenceNotable Structural Features
    P. mendocinaUbiquinoneMore hydrophobic transmembrane domains
    P. aeruginosaUbiquinone/menaquinoneVariations in quinone-binding residues
  • Pathogenicity correlations - While P. mendocina rarely causes human infections (only 14 reported cases worldwide) , P. aeruginosa is a common opportunistic pathogen. Differences in respiratory chain components like nuoK may contribute to these varying pathogenic potentials.

  • Energy conservation efficiency - Structural variations may affect proton pumping efficiency and therefore the energy conservation capabilities of different species .

  • Drug target potential - Species-specific variations in nuoK could be exploited for selective inhibition, potentially allowing for species-specific antimicrobial development .

Understanding these variations requires comprehensive structural analysis through homology modeling, protein crystallography, or cryo-EM approaches, combined with functional studies to correlate structural differences with functional consequences.

What are the main challenges in purifying functional recombinant nuoK protein?

Purifying functional recombinant nuoK presents several challenges due to its membrane-integrated nature:

  • Hydrophobicity - The highly hydrophobic character of nuoK (evidenced by its amino acid sequence) makes it prone to aggregation during extraction from membranes .

  • Maintaining native conformation - Preserving the functional conformation of nuoK requires careful selection of detergents and lipids:

    Detergent/LipidAdvantagesLimitations
    DDM (n-Dodecyl β-D-maltoside)Mild, preserves functionExpensive, forms large micelles
    LMNG (Lauryl maltose neopentyl glycol)Smaller micelles, stableLess established for nuoK
    Native lipid supplementationMaintains native environmentBatch variation, complexity
  • Context-dependent functionality - nuoK functions as part of a multi-subunit complex, making it challenging to assess its isolated activity .

  • Expression yield limitations - Membrane proteins typically express at lower levels than soluble proteins, requiring optimization of:

    • Promoter strength

    • Induction conditions

    • Host strain selection

    • Fusion partners/tags

    • Growth temperature and media composition

  • Solution strategies:

    • Use fusion tags designed for membrane proteins (e.g., Mistic, GFP)

    • Consider co-expression with other subunits to stabilize structure

    • Implement high-throughput screening of expression and purification conditions

    • Validate protein functionality through reconstitution experiments

Researchers should prioritize maintaining nuoK in a lipid-like environment throughout purification to preserve its native structure and function.

How can researchers effectively study the interactions between nuoK and other components of the NADH-quinone oxidoreductase complex?

Investigating the interactions between nuoK and other components of the NADH-quinone oxidoreductase complex requires specialized approaches:

  • Co-immunoprecipitation (Co-IP) - Using antibodies against nuoK or other subunits to pull down interaction partners. This approach works best for relatively stable interactions but may miss transient associations.

  • Bacterial two-hybrid systems - Modified for membrane proteins to detect protein-protein interactions in vivo. This approach is particularly valuable for screening potential interaction partners.

  • Nanodiscs or proteoliposome reconstitution - Reconstituting nuoK with other subunits in defined lipid environments allows functional studies of interactions:

    Reconstitution MethodAdvantagesApplications
    NanodiscsDefined size, monodisperseStructural studies, single-molecule analysis
    ProteoliposomesMore native-like membraneFunctional assays, proton pumping measurements
    AmphipolsStabilize membrane proteinsCryo-EM, binding studies
  • Cryo-electron microscopy - For structural visualization of the entire complex, revealing the spatial relationships between nuoK and other subunits at near-atomic resolution .

  • Complementation assays - Testing the ability of nuoK variants to restore function when expressed in strains lacking functional nuoK, particularly when co-expressed with other subunits.

By combining multiple approaches, researchers can build a comprehensive picture of how nuoK integrates with other components to form a functional respiratory complex.

How can nuoK research contribute to understanding antimicrobial resistance in Pseudomonas species?

Research on nuoK and the NADH-quinone oxidoreductase complex offers several promising avenues for addressing antimicrobial resistance in Pseudomonas species:

  • Novel drug target development - The essential role of respiratory complexes in bacterial energy metabolism makes nuoK a potential target for new antimicrobials. Unlike P. aeruginosa which is frequently resistant to multiple antibiotics, P. mendocina infections have shown susceptibility to common antibiotics like ceftazidime, sulfamethoxazole/trimethoprim, and ceftriaxone .

  • Bacterial energy metabolism adaptation - Understanding how respiratory chain components like nuoK adapt under antibiotic stress may reveal mechanisms of metabolic adaptation contributing to resistance:

    Metabolic AdaptationRelationship to nuoKResistance Implication
    Electron transport chain remodelingAlternative quinone usageAdaptation to membrane-targeting antibiotics
    Altered proton motive forceChanged nuoK activityReduced uptake of positively charged antibiotics
    Metabolic dormancyDownregulation of respiratory complexesTolerance to antibiotics targeting active processes
  • Biofilm formation - Respiratory chain components may influence biofilm formation capacity, which is strongly associated with antimicrobial resistance in Pseudomonas species.

  • Species-specific targeting - The differences between nuoK across Pseudomonas species could potentially be exploited to develop species-specific inhibitors, reducing disruption to beneficial microbiota .

  • Combination therapy approaches - Inhibiting respiratory chain components like nuoK may sensitize resistant bacteria to existing antibiotics by reducing energy availability for efflux pumps and other resistance mechanisms.

Future research should focus on comparative analyses of nuoK structure and function between antibiotic-susceptible and resistant strains to identify structural or functional adaptations that contribute to resistance phenotypes.

What are the potential applications of recombinant nuoK protein in biotechnology?

Recombinant nuoK protein and research on NADH-quinone oxidoreductases have several potential biotechnological applications:

  • Bioenergy applications - Understanding electron transport chain components like nuoK can inform the development of:

    • Microbial fuel cells using Pseudomonas species

    • Engineered systems for bioelectricity generation

    • Optimized biocatalysts for industrial redox reactions

  • Biosensors - The quinone-reducing activity of NADH-quinone oxidoreductase complexes could be harnessed to develop biosensors for:

    TargetSensing PrinciplePotential Applications
    NADH levelsNADH oxidation coupled to reporterMetabolic state monitoring
    QuinonesQuinone reduction detectionEnvironmental toxin detection
    Respiratory inhibitorsActivity inhibitionDrug screening platforms
  • Protein engineering - Using knowledge of nuoK structure-function relationships to engineer:

    • Proton pumps with modified specificity

    • Membrane proteins with enhanced stability

    • Novel electron transfer modules for synthetic biology applications

  • Bioremediation - Pseudomonas species are known for their metabolic versatility and capacity to degrade environmental pollutants. Understanding and potentially enhancing their respiratory chains could improve their bioremediation capabilities .

  • Screening platforms for quinone-modifying enzymes - The quinone oxidoreductase activity associated with the complex containing nuoK could be used to develop screening systems for enzymes that modify quinones, which have applications in pharmaceutical development .

The development of these applications requires further characterization of the kinetic properties, stability, and substrate specificity of nuoK and the NADH-quinone oxidoreductase complex under various conditions.

What are the key unsolved questions in nuoK research?

Despite advances in understanding NADH-quinone oxidoreductase complexes, several crucial questions about nuoK remain unanswered:

  • Structure-function relationships - How do specific amino acid residues in nuoK contribute to proton translocation and interaction with other subunits? High-resolution structural studies combined with mutagenesis approaches are needed.

  • Evolutionary adaptation - How has nuoK evolved across different Pseudomonas species to adapt to diverse ecological niches? Comparative genomics and molecular evolution studies could address this question.

  • Regulatory mechanisms - How is nuoK expression regulated under different environmental conditions, and how does this contribute to bacterial adaptation? Transcriptomic and proteomic studies under various growth conditions would be informative.

  • Role in pathogenesis - What is the contribution of nuoK to bacterial virulence and host interaction in pathogenic Pseudomonas species? While P. mendocina rarely causes human infections, understanding its respiratory chain may provide insights into more pathogenic species .

  • Protein-lipid interactions - How do specific lipid environments affect nuoK structure and function? This remains poorly understood for many membrane proteins including nuoK.

  • Integration with other metabolic pathways - How does the activity of nuoK and the NADH-quinone oxidoreductase complex integrate with and respond to changes in other metabolic pathways?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology.

What methodological advances are needed to accelerate nuoK research?

Future progress in nuoK research depends on several methodological advances:

  • Improved membrane protein expression systems - Development of expression systems specifically optimized for challenging membrane proteins like nuoK, potentially including:

    • Designer lipid environments

    • Specialized fusion partners

    • Cell-free expression systems with membrane mimetics

  • Advanced structural biology techniques - Further refinement of:

    TechniqueCurrent LimitationNeeded Advancement
    Cryo-EMResolution for small membrane proteinsEnhanced signal detection for smaller proteins
    X-ray crystallographyCrystallization challengesAutomated screening for membrane protein crystals
    NMR spectroscopySize limitationsMethods for larger membrane protein complexes
  • In situ probing technologies - Development of techniques to study nuoK in its native membrane environment without disruption:

    • Advanced fluorescence techniques for membrane protein dynamics

    • In-cell structural biology approaches

    • Improved membrane protein labeling strategies

  • Computational methods - Enhanced computational approaches for:

    • Predicting membrane protein structures with higher accuracy

    • Modeling proton transfer pathways

    • Simulating protein-lipid interactions over longer timescales

  • High-throughput functional assays - Development of scalable assays to:

    • Screen for nuoK inhibitors

    • Assess the impact of mutations on function

    • Measure subtle changes in proton pumping efficiency

  • Improved reconstitution systems - Advanced membrane mimetic systems that better recapitulate the native membrane environment while allowing precise experimental control.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.