Recombinant nuoK is a 102-amino acid protein (UniProt ID: A4XV11) expressed in E. coli with an N-terminal His-tag for purification . Key characteristics include:
nuoK is a subunit of NADH-quinone oxidoreductase (Complex I), which catalyzes electron transfer from NADH to quinones, contributing to the proton gradient across the bacterial membrane . Key functional insights:
Electron Transport: Facilitates NADH oxidation and quinone reduction () .
Genomic Context: Located in the nuo operon of P. mendocina NK-01, which also encodes other subunits of Complex I (e.g., nuoA, nuoB) .
Physiological Relevance: Critical for energy production under aerobic conditions and stress responses linked to quinone detoxification .
The primary sequence of nuoK is:
MTGIPMEHGLALAAALFCIGLVGLMVRRNILFILMSLEVMMNAAALAFVVAGARWGQPDGQVMFIMVITLAAAEASIGLAILLQLYRRFNTLDIDAASEMRG .
Recombinant nuoK is widely used in:
Enzyme Kinetics: Studying quinone reduction mechanisms and inhibitor screening (e.g., rotenone analogs) .
Structural Biology: Crystallization trials to resolve Complex I architecture .
Biotechnological Studies: Investigating bacterial respiratory adaptations in polyhydroxyalkanoate (PHA) synthesis pathways .
nuoK shares functional homology with subunits in other Pseudomonas species and pathogens like Mycobacterium bovis . Key distinctions include:
| Species | Gene Locus | Protein Length | UniProt ID |
|---|---|---|---|
| P. mendocina | Pmen_2421 | 102 aa | A4XV11 |
| M. bovis | BCG_3178 | 99 aa | A1KNF1 |
| P. aeruginosa | Multiple loci | Variable | Q9I6T9 |
Activity Assays: Requires reconstitution in lipid bilayers or detergent micelles to mimic native membrane environments .
Inhibition Studies: Sensitive to diphenyleneiodonium (DPI) and other Complex I inhibitors .
Commercial Availability: Sold as lyophilized powder (e.g., Creative BioMart, Labprice) for ELISA and biochemical assays .
The nuoK gene in P. mendocina NK-01 is part of a 5.4-Mbp circular chromosome (62.51% GC content), distinct from the P. mendocina ymp strain (5.07 Mbp, 64% GC) . Evolutionary conservation of nuoK across bacteria underscores its essential role in aerobic respiration .
KEGG: pmy:Pmen_2421
STRING: 399739.Pmen_2421
NADH-quinone oxidoreductase plays a critical role in bacterial energy metabolism by catalyzing the transfer of electrons from NADH to quinones in the respiratory chain. This process is fundamental to cellular respiration and ATP generation. In Pseudomonas species, the NADH dehydrogenase complex (which includes the nuoK subunit) participates in:
Electron transport chain functionality
Energy conservation through proton translocation
Redox balance maintenance within the cell
These enzymes are particularly important for bacterial survival under various growth conditions, contributing to their metabolic versatility .
The NADH-quinone oxidoreductase complex contains multiple subunits (designated as nuoA through nuoN in Pseudomonas species), each with specific functions:
The nuoK subunit is primarily involved in the membrane-embedded portion of the complex, contributing to proton translocation across the membrane rather than direct electron transfer .
For optimal preservation of recombinant Pseudomonas mendocina nuoK protein activity and stability, the following storage protocol is recommended:
Short-term storage (up to one week): Store working aliquots at 4°C
Medium-term storage: Store at -20°C in buffer containing 50% glycerol
Long-term storage: Store at -80°C in Tris-based buffer with 50% glycerol
Avoid repeated freeze-thaw cycles as they significantly reduce protein stability and activity
The addition of glycerol is critical as it prevents the formation of ice crystals that can denature the protein during freeze-thaw cycles. For experimental preparations, it is advisable to prepare small working aliquots to minimize degradation from repeated thawing .
The optimal expression system for recombinant nuoK protein production depends on experimental requirements and research goals:
| Expression System | Advantages | Limitations | Typical Yield |
|---|---|---|---|
| E. coli | Fast growth, simple genetics, economical | May lack proper post-translational modifications | Moderate to high |
| Yeast | Eukaryotic post-translational modifications | Longer growth time than bacteria | Moderate |
| Baculovirus | High-level expression of membrane proteins | Complex system, expensive | High |
| Mammalian cells | Native-like protein folding and modifications | Most complex and expensive | Low to moderate |
For membrane proteins like nuoK, E. coli or baculovirus expression systems are commonly employed, with the choice depending on whether native folding or high yield is prioritized . The host organism selection should be determined based on the specific experimental requirements and downstream applications.
When encountering contradictory data in nuoK functional studies, researchers should follow a systematic approach:
Examine the data thoroughly - Identify specific discrepancies between expected and observed results. For membrane proteins like nuoK, inconsistencies often relate to purification conditions affecting protein conformation .
Evaluate initial assumptions - Re-evaluate the hypothesis about nuoK function. Consider whether the protein might have different roles under varying experimental conditions .
Consider alternative explanations - For nuoK specifically, contradictory results might arise from:
Modify experimental approaches - Implement alternative methods to validate findings:
| Method | Application for nuoK Research | Data Output |
|---|---|---|
| Enzyme activity assays | Measure quinone reduction rates | Quantitative kinetic parameters |
| Protein-protein interaction studies | Identify interactions with other Nuo subunits | Binding affinities, complex formation |
| Mutagenesis | Determine essential residues for function | Structure-function relationships |
Integrate mixed methods data - Combine different data types (structural, biochemical, genetic) to develop a more comprehensive understanding of nuoK function .
Contradictory results should be viewed as opportunities for discovery rather than experimental failures, as they may reveal novel aspects of nuoK function or regulation .
The study of nuoK enzyme kinetics requires specialized approaches due to its membrane-bound nature and participation in a multi-subunit complex:
For comprehensive kinetic analysis, researchers should combine multiple approaches while considering that nuoK functions as part of a larger complex and may not show independent catalytic activity .
Differentiating the specific contributions of nuoK from other NADH-quinone oxidoreductase components requires sophisticated experimental approaches:
Site-directed mutagenesis - Introducing specific mutations in conserved residues of nuoK can identify amino acids critical for proton translocation without affecting electron transfer mediated by other subunits.
Subunit-selective inhibition - Some inhibitors may preferentially affect membrane-embedded subunits like nuoK versus peripheral components:
| Inhibitor Type | Primary Target | Effect on nuoK |
|---|---|---|
| Rotenone | NADH binding site | Indirect inhibition |
| Piericidin A | Quinone binding site | Indirect inhibition |
| Hydrophobic uncouplers | Proton channels | Direct disruption of nuoK function |
Complementation studies - Express wild-type or mutant nuoK in knockout strains to assess restoration of specific functions .
Cryo-EM or X-ray crystallography - Structural studies can reveal the spatial arrangement of nuoK relative to other subunits and help identify functional interfaces .
By combining these approaches, researchers can build a comprehensive understanding of nuoK's specific role within the larger NADH-quinone oxidoreductase complex.
The structural variations in nuoK between different Pseudomonas species have significant implications for bacterial physiology and potential biotechnological applications:
Adaptation to ecological niches - Variations in nuoK structure may reflect adaptations to different environmental conditions where various Pseudomonas species thrive. For example, P. mendocina (primarily found in soil and water) may have nuoK adaptations distinct from P. aeruginosa (frequently associated with clinical infections) .
Substrate specificity differences - Structural variations can lead to different quinone preferences:
| Pseudomonas Species | Primary Quinone Preference | Notable Structural Features |
|---|---|---|
| P. mendocina | Ubiquinone | More hydrophobic transmembrane domains |
| P. aeruginosa | Ubiquinone/menaquinone | Variations in quinone-binding residues |
Pathogenicity correlations - While P. mendocina rarely causes human infections (only 14 reported cases worldwide) , P. aeruginosa is a common opportunistic pathogen. Differences in respiratory chain components like nuoK may contribute to these varying pathogenic potentials.
Energy conservation efficiency - Structural variations may affect proton pumping efficiency and therefore the energy conservation capabilities of different species .
Drug target potential - Species-specific variations in nuoK could be exploited for selective inhibition, potentially allowing for species-specific antimicrobial development .
Understanding these variations requires comprehensive structural analysis through homology modeling, protein crystallography, or cryo-EM approaches, combined with functional studies to correlate structural differences with functional consequences.
Purifying functional recombinant nuoK presents several challenges due to its membrane-integrated nature:
Hydrophobicity - The highly hydrophobic character of nuoK (evidenced by its amino acid sequence) makes it prone to aggregation during extraction from membranes .
Maintaining native conformation - Preserving the functional conformation of nuoK requires careful selection of detergents and lipids:
| Detergent/Lipid | Advantages | Limitations |
|---|---|---|
| DDM (n-Dodecyl β-D-maltoside) | Mild, preserves function | Expensive, forms large micelles |
| LMNG (Lauryl maltose neopentyl glycol) | Smaller micelles, stable | Less established for nuoK |
| Native lipid supplementation | Maintains native environment | Batch variation, complexity |
Context-dependent functionality - nuoK functions as part of a multi-subunit complex, making it challenging to assess its isolated activity .
Expression yield limitations - Membrane proteins typically express at lower levels than soluble proteins, requiring optimization of:
Solution strategies:
Researchers should prioritize maintaining nuoK in a lipid-like environment throughout purification to preserve its native structure and function.
Investigating the interactions between nuoK and other components of the NADH-quinone oxidoreductase complex requires specialized approaches:
Co-immunoprecipitation (Co-IP) - Using antibodies against nuoK or other subunits to pull down interaction partners. This approach works best for relatively stable interactions but may miss transient associations.
Bacterial two-hybrid systems - Modified for membrane proteins to detect protein-protein interactions in vivo. This approach is particularly valuable for screening potential interaction partners.
Nanodiscs or proteoliposome reconstitution - Reconstituting nuoK with other subunits in defined lipid environments allows functional studies of interactions:
| Reconstitution Method | Advantages | Applications |
|---|---|---|
| Nanodiscs | Defined size, monodisperse | Structural studies, single-molecule analysis |
| Proteoliposomes | More native-like membrane | Functional assays, proton pumping measurements |
| Amphipols | Stabilize membrane proteins | Cryo-EM, binding studies |
Cryo-electron microscopy - For structural visualization of the entire complex, revealing the spatial relationships between nuoK and other subunits at near-atomic resolution .
Complementation assays - Testing the ability of nuoK variants to restore function when expressed in strains lacking functional nuoK, particularly when co-expressed with other subunits.
By combining multiple approaches, researchers can build a comprehensive picture of how nuoK integrates with other components to form a functional respiratory complex.
Research on nuoK and the NADH-quinone oxidoreductase complex offers several promising avenues for addressing antimicrobial resistance in Pseudomonas species:
Novel drug target development - The essential role of respiratory complexes in bacterial energy metabolism makes nuoK a potential target for new antimicrobials. Unlike P. aeruginosa which is frequently resistant to multiple antibiotics, P. mendocina infections have shown susceptibility to common antibiotics like ceftazidime, sulfamethoxazole/trimethoprim, and ceftriaxone .
Bacterial energy metabolism adaptation - Understanding how respiratory chain components like nuoK adapt under antibiotic stress may reveal mechanisms of metabolic adaptation contributing to resistance:
| Metabolic Adaptation | Relationship to nuoK | Resistance Implication |
|---|---|---|
| Electron transport chain remodeling | Alternative quinone usage | Adaptation to membrane-targeting antibiotics |
| Altered proton motive force | Changed nuoK activity | Reduced uptake of positively charged antibiotics |
| Metabolic dormancy | Downregulation of respiratory complexes | Tolerance to antibiotics targeting active processes |
Biofilm formation - Respiratory chain components may influence biofilm formation capacity, which is strongly associated with antimicrobial resistance in Pseudomonas species.
Species-specific targeting - The differences between nuoK across Pseudomonas species could potentially be exploited to develop species-specific inhibitors, reducing disruption to beneficial microbiota .
Combination therapy approaches - Inhibiting respiratory chain components like nuoK may sensitize resistant bacteria to existing antibiotics by reducing energy availability for efflux pumps and other resistance mechanisms.
Future research should focus on comparative analyses of nuoK structure and function between antibiotic-susceptible and resistant strains to identify structural or functional adaptations that contribute to resistance phenotypes.
Recombinant nuoK protein and research on NADH-quinone oxidoreductases have several potential biotechnological applications:
Bioenergy applications - Understanding electron transport chain components like nuoK can inform the development of:
Microbial fuel cells using Pseudomonas species
Engineered systems for bioelectricity generation
Optimized biocatalysts for industrial redox reactions
Biosensors - The quinone-reducing activity of NADH-quinone oxidoreductase complexes could be harnessed to develop biosensors for:
| Target | Sensing Principle | Potential Applications |
|---|---|---|
| NADH levels | NADH oxidation coupled to reporter | Metabolic state monitoring |
| Quinones | Quinone reduction detection | Environmental toxin detection |
| Respiratory inhibitors | Activity inhibition | Drug screening platforms |
Protein engineering - Using knowledge of nuoK structure-function relationships to engineer:
Bioremediation - Pseudomonas species are known for their metabolic versatility and capacity to degrade environmental pollutants. Understanding and potentially enhancing their respiratory chains could improve their bioremediation capabilities .
Screening platforms for quinone-modifying enzymes - The quinone oxidoreductase activity associated with the complex containing nuoK could be used to develop screening systems for enzymes that modify quinones, which have applications in pharmaceutical development .
The development of these applications requires further characterization of the kinetic properties, stability, and substrate specificity of nuoK and the NADH-quinone oxidoreductase complex under various conditions.
Despite advances in understanding NADH-quinone oxidoreductase complexes, several crucial questions about nuoK remain unanswered:
Structure-function relationships - How do specific amino acid residues in nuoK contribute to proton translocation and interaction with other subunits? High-resolution structural studies combined with mutagenesis approaches are needed.
Evolutionary adaptation - How has nuoK evolved across different Pseudomonas species to adapt to diverse ecological niches? Comparative genomics and molecular evolution studies could address this question.
Regulatory mechanisms - How is nuoK expression regulated under different environmental conditions, and how does this contribute to bacterial adaptation? Transcriptomic and proteomic studies under various growth conditions would be informative.
Role in pathogenesis - What is the contribution of nuoK to bacterial virulence and host interaction in pathogenic Pseudomonas species? While P. mendocina rarely causes human infections, understanding its respiratory chain may provide insights into more pathogenic species .
Protein-lipid interactions - How do specific lipid environments affect nuoK structure and function? This remains poorly understood for many membrane proteins including nuoK.
Integration with other metabolic pathways - How does the activity of nuoK and the NADH-quinone oxidoreductase complex integrate with and respond to changes in other metabolic pathways?
Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology.
Future progress in nuoK research depends on several methodological advances:
Improved membrane protein expression systems - Development of expression systems specifically optimized for challenging membrane proteins like nuoK, potentially including:
Designer lipid environments
Specialized fusion partners
Cell-free expression systems with membrane mimetics
Advanced structural biology techniques - Further refinement of:
| Technique | Current Limitation | Needed Advancement |
|---|---|---|
| Cryo-EM | Resolution for small membrane proteins | Enhanced signal detection for smaller proteins |
| X-ray crystallography | Crystallization challenges | Automated screening for membrane protein crystals |
| NMR spectroscopy | Size limitations | Methods for larger membrane protein complexes |
In situ probing technologies - Development of techniques to study nuoK in its native membrane environment without disruption:
Advanced fluorescence techniques for membrane protein dynamics
In-cell structural biology approaches
Improved membrane protein labeling strategies
Computational methods - Enhanced computational approaches for:
High-throughput functional assays - Development of scalable assays to:
Screen for nuoK inhibitors
Assess the impact of mutations on function
Measure subtle changes in proton pumping efficiency
Improved reconstitution systems - Advanced membrane mimetic systems that better recapitulate the native membrane environment while allowing precise experimental control.