Recombinant Pseudomonas mendocina Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; Pmen_0521; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-527
Protein Length
full length protein
Species
Pseudomonas mendocina (strain ymp)
Target Names
ubiB
Target Protein Sequence
MKLLAVRRLLRIQRVVIRYQLDELLLELPLPFWLRALSWLLPWRWLPRRPLALSRGARLR LALEDLGPIFIKFGQLLSTRRDLLPPDIADELARLQDQVPPFPEDQAIALIERQLGAPVS QLFARFDSQPLASASVAQVHAAQLKSGEEVVVKVVRPGLKPVIRQDLAWLFLLARIAERA SADARRLRPVEVVSDYEKTIFDELDLLREAANASQLRRNFEGSPLLYVPQVYWDLCRHQV LVMERIYGVPVTDLATLADQRTDMKLLAERGVEIFFTQVFRDSFFHADMHPGNIFVSTRT PWSPQYIAIDCGIIGSLTDEDQDYLARNLIAFFKRDYRKVAQLHIDSGWVPADTKVNEFE AAIRTVCEPIFEKPLKDISFGQLLLRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQLY PDLDLWSTAQPFLERWMRERVSPLHLLRNLQQQAEQVPHLSQIARDALERLQRPEPPRES DARDQWPLRLLGAALIAAGAVQGLAPLLATWPAWLMVGGGLYLVLRR
Uniprot No.

Target Background

Function

This recombinant Pseudomonas mendocina protein is a probable protein kinase regulator of UbiI activity, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.

Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas mendocina and why is it significant for ubiquinone research?

Pseudomonas mendocina is a Gram-negative, aerobic, rod-shaped bacterium belonging to the Pseudomonadaceae family, naturally found in water and soil samples. First discovered in 1969, it has gained research interest due to its metabolic versatility and unique biosynthetic pathways . P. mendocina serves as an important model organism for studying ubiquinone biosynthesis, particularly through the UbiB protein, which plays a crucial role in the aerobic hydroxylation steps of ubiquinone production. This bacterium's relatively rare occurrence in human infections (with only 14 documented cases worldwide as of 2019) makes it an interesting subject for both environmental microbiology and specialized clinical research .

What is the structural composition of the recombinant UbiB protein from P. mendocina?

The recombinant P. mendocina UbiB protein (UniProt accession: A4XPM5) is a full-length protein consisting of 527 amino acids. Its complete sequence begins with MKLLAVRRLLRIQRVVIRY and continues through to LVGGGLYLVLRR at the C-terminus . The protein contains multiple functional domains characteristic of ubiquinone biosynthesis proteins, including kinase-like domains that are essential for its activity. When produced as a recombinant protein, it is typically stored in a Tris-based buffer with 50% glycerol for stability and maintained at -20°C for standard storage or -80°C for extended preservation . The tertiary structure features catalytic sites involved in the hydroxylation reactions necessary for ubiquinone synthesis.

How does UbiB contribute to the ubiquinone biosynthetic pathway?

UbiB is a probable ubiquinone biosynthesis protein that functions as part of the aerobic ubiquinone (UQ) biosynthetic pathway. While its exact biochemical function is still being elucidated, research suggests it plays a role similar to that of kinase-like proteins in the ubiquinone biosynthetic pathway. UbiB likely participates in the hydroxylation steps required for the conversion of early precursors into functional ubiquinone, which serves as the major electron carrier in the reduction of oxygen during aerobic respiration .

In P. aeruginosa and related Pseudomonas species, ubiquinone (specifically UQ9 - ubiquinone with nine isoprenoid units) has been identified as the predominant quinone essential for growth during anaerobic respiration, particularly during denitrification processes . By extension, UbiB in P. mendocina likely plays a similar critical role in the synthesis of ubiquinone molecules necessary for both aerobic and possibly anaerobic respiratory mechanisms.

What are the optimal conditions for expressing recombinant P. mendocina UbiB protein?

Based on established protocols for similar Pseudomonas recombinant proteins, optimal expression of P. mendocina UbiB can be achieved using the following methodological approach:

Expression System Selection:

  • E. coli BL21(DE3) or Rosetta(DE3) strains typically yield high expression levels for Pseudomonas proteins

  • pET-based vectors containing T7 promoters provide controlled, high-yield expression

Culture Conditions:

  • Initial growth at 37°C to OD600 of 0.6-0.8

  • Temperature reduction to 18-25°C before induction to enhance soluble protein production

  • Induction with 0.1-0.5 mM IPTG for 16-20 hours

Expression Optimization Table:

ParameterStandard ConditionOptimization RangeNotes
Growth temperature37°C30-37°CHigher temperatures increase growth rate
Induction temperature18°C16-25°CLower temperatures reduce inclusion body formation
IPTG concentration0.2 mM0.1-1.0 mMExcessive IPTG can lead to toxicity
Post-induction time18 hours4-24 hoursLonger times may increase yield but risk degradation
Media compositionLBLB, TB, 2×YTRich media (TB) increases biomass but may affect folding

The addition of 0.5-1% glucose during the growth phase can help reduce basal expression leakage, while supplementation with iron compounds (50-100 μM FeSO4) may improve the incorporation of potential iron-sulfur clusters if present in the native protein structure.

What purification strategy yields the highest activity for recombinant UbiB?

Purification of active recombinant UbiB requires a multi-step approach that preserves the protein's catalytic capabilities:

Primary Purification:

  • Cell lysis using sonication or pressure-based systems in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and 1 mM DTT

  • Initial purification via Immobilized Metal Affinity Chromatography (IMAC) if the recombinant protein contains a histidine tag

  • Secondary purification using ion exchange chromatography (typically Q-Sepharose)

  • Final polishing step using size exclusion chromatography

Critical Considerations:

  • Inclusion of reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) throughout purification to prevent oxidation of critical cysteine residues

  • Addition of glycerol (10-20%) to stabilize the protein structure during purification and storage

  • Potential requirement for specific cofactors (such as flavin or iron) to maintain the protein's functional state

Activity Preservation Method:
Store purified UbiB in 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 50% glycerol, 1 mM DTT at -20°C for routine use, or aliquot and store at -80°C for long-term preservation . Avoid repeated freeze-thaw cycles as this significantly reduces enzymatic activity.

How can researchers assess the functional activity of purified UbiB?

Functional assessment of UbiB activity can be performed through several complementary approaches:

In vitro Enzymatic Assays:

  • Kinase-like Activity Assay: Monitor ATP consumption using luciferase-based ATP detection systems or radioactive [γ-32P]ATP

  • Hydroxylation Activity Assay: Measure the conversion of isotopically labeled substrates to hydroxylated products using HPLC-MS/MS

Complementation Studies:

  • Transform UbiB-deficient bacterial strains with plasmids expressing the recombinant P. mendocina UbiB

  • Assess restoration of ubiquinone biosynthesis through:

    • Growth under conditions requiring respiratory chain function

    • Direct measurement of ubiquinone levels using HPLC analysis

Protein-Protein Interaction Studies:

  • Use pull-down assays, bacterial two-hybrid systems, or surface plasmon resonance to identify interactions with other ubiquinone biosynthesis pathway components

  • Cross-validation with co-immunoprecipitation using antibodies against native interaction partners

These methods provide complementary information about both the catalytic activity and biological significance of the purified UbiB protein.

How does UbiB function differ between aerobic and anaerobic conditions in Pseudomonas species?

Recent research has revealed that ubiquinone biosynthesis in Pseudomonas species involves distinct pathways under aerobic and anaerobic conditions, with potential implications for UbiB function:

In related bacteria like E. coli, the UbiU, UbiV, and UbiT proteins form a complex essential for anaerobic ubiquinone biosynthesis . Homologs of these genes have been identified in P. aeruginosa (PA3911, PA3912, and PA3913), suggesting a similar mechanism may exist in Pseudomonas species.

While UbiB's precise role in these distinct pathways is still being elucidated, the protein likely functions differently depending on oxygen availability:

Comparative Function Analysis:

ConditionProposed UbiB FunctionAssociated Pathway ComponentsRegulatory Mechanisms
AerobicOxygen-dependent hydroxylation step mediatorClassical UQ biosynthesis enzymesTranscriptional regulation by oxygen-sensing factors
AnaerobicPotential interaction with UbiU/UbiV/UbiT complexAlternative hydroxylation machineryPossibly regulated by anaerobic response elements

Research methodologies to investigate these differences should include comparative proteomics under aerobic versus anaerobic conditions, metabolic flux analysis of ubiquinone intermediates, and protein interaction studies specific to each condition.

What is the relationship between ubiquinone biosynthesis and light-responsive gene regulation in P. mendocina?

An intriguing area of research involves the potential interplay between ubiquinone biosynthesis and light-responsive gene regulation in P. mendocina. Studies have identified that P. mendocina contains a blue light-responsive system involving PmlR2 (a class II LitR/CarH family transcriptional regulator) and PmSB-LOV (a "short" LOV-type blue light photoreceptor) .

When exposed to blue light, PmSB-LOV undergoes a conformational change that allows it to directly associate with PmlR2, inhibiting the DNA-binding ability of PmlR2 . This inhibition enables RNA polymerase to access and transcribe light-inducible genes.

While the direct relationship between this light-sensing system and ubiquinone biosynthesis has not been fully established, several hypothetical connections exist:

  • Ubiquinone's role as an electron carrier in photosynthetic bacteria suggests possible regulatory connections between light perception and electron transport chain components

  • The redox state influenced by ubiquinone may serve as a feedback mechanism for light-responsive gene regulation

  • Both systems may be co-regulated as part of the bacterium's adaptation to environmental conditions

Methodological approach to investigate this relationship:

  • Transcriptomic analysis comparing wild-type and UbiB-deficient strains under different light conditions

  • Metabolomic profiling of ubiquinone levels in response to light exposure

  • Chromatin immunoprecipitation sequencing (ChIP-seq) to identify potential binding sites of PmlR2 near ubiquinone biosynthesis genes

  • Construction of reporter gene fusions to monitor expression of UbiB and other ubiquinone biosynthesis genes under varying light conditions

How can structural biology approaches enhance our understanding of UbiB function?

Advanced structural biology methods offer powerful tools for elucidating UbiB's functional mechanisms:

X-ray Crystallography and Cryo-EM:
Determining the high-resolution structure of UbiB would reveal critical insights into its catalytic mechanism, substrate binding sites, and potential interaction surfaces. Researchers should consider the following methodological approaches:

  • Protein engineering to improve crystallization properties:

    • Surface entropy reduction

    • Truncation of disordered regions

    • Incorporation of crystallization chaperones

  • Co-crystallization with:

    • Substrate analogs

    • ATP or other potential cofactors

    • Interaction partners from the ubiquinone biosynthesis pathway

Molecular Dynamics Simulations:
Following structural determination, molecular dynamics simulations can predict:

  • Conformational changes during catalysis

  • Substrate access routes

  • Effects of mutations on protein stability and function

Integrative Structural Biology Approach:
Combine multiple methods for a comprehensive understanding:

These structural insights would guide the design of targeted mutations to test mechanistic hypotheses and potentially enable the development of specific inhibitors or activators of UbiB function.

How does P. mendocina UbiB compare to homologous proteins in other bacterial species?

Comparative analysis of UbiB across bacterial species reveals evolutionary adaptations and functional conservation:

The UbiB protein belongs to a conserved family of proteins involved in ubiquinone biosynthesis across diverse bacterial species. In P. mendocina, UbiB (encoded by the ubiB gene, locus Pmen_0521) shares significant sequence and functional similarity with homologs in other bacteria .

Comparative Analysis Table:

SpeciesProtein Identity to P. mendocina UbiBKey Structural DifferencesFunctional Implications
E. coli~60-70%Extended N-terminal regionPotentially different regulation
P. aeruginosa~85-90%High conservation in catalytic domainsSimilar catalytic mechanism
P. stutzeri~80-85%Similar domain organizationLikely functional equivalence
Non-Pseudomonas proteobacteria~50-60%Variable loop regionsAdapted to different substrate specificities

Research methodologies to explore these differences should include:

  • Phylogenetic analysis: Construct comprehensive phylogenetic trees of UbiB proteins to trace evolutionary relationships and identify potential horizontal gene transfer events

  • Domain swapping experiments: Create chimeric proteins with domains from different species to map functional regions

  • Heterologous complementation tests: Express P. mendocina UbiB in other bacterial species with UbiB deletions to assess functional conservation

This comparative approach provides insights into both the core conserved functions of UbiB and species-specific adaptations that may relate to different ecological niches or metabolic requirements.

What are the potential biotechnological applications of recombinant P. mendocina UbiB?

Understanding and manipulating UbiB offers several promising biotechnological applications:

Bioprocess Engineering:

  • Enhanced ubiquinone (CoQ10) production: Engineered overexpression of UbiB and other pathway components could increase ubiquinone yields for commercial production

  • Bioremediation applications: P. mendocina strains with modified UbiB could potentially enhance degradation of recalcitrant environmental pollutants through improved electron transport capabilities

Pharmaceutical Research:

  • Antimicrobial drug development: UbiB represents a potential target for novel antibiotics against Pseudomonas infections, which is particularly relevant given P. mendocina's documented role in human infections

  • Development of inhibitor screening platforms: Recombinant UbiB could be used to develop high-throughput screening systems to identify novel inhibitors of bacterial ubiquinone biosynthesis

Synthetic Biology:

  • Creation of artificial electron transport chains: Engineered UbiB variants could potentially enable the design of synthetic electron transport systems with novel properties

  • Biosensor development: UbiB-based biosensors could potentially detect specific metabolites or environmental conditions by coupling ubiquinone biosynthesis to reporter systems

The development of these applications would require comprehensive understanding of UbiB's structure-function relationships, catalytic mechanisms, and regulatory networks.

What methodological advances are needed to resolve current knowledge gaps about UbiB function?

Several methodological advances would significantly enhance our understanding of UbiB function:

Technical Innovations Needed:

  • Improved in vitro reconstitution systems:

    • Development of membrane-mimetic systems that better recapitulate the native environment of UbiB

    • Establishment of coupled enzyme assays to monitor UbiB activity in real-time

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize UbiB localization and dynamics in living cells

    • Correlative light and electron microscopy to connect UbiB localization with membrane ultrastructure

  • Genetic tools for P. mendocina:

    • CRISPR-Cas9 based genome editing systems optimized for P. mendocina

    • Inducible promoter systems for controlled gene expression

    • Transposon mutagenesis libraries for high-throughput functional screening

  • Metabolic flux analysis:

    • Isotope-labeled precursor studies to trace ubiquinone biosynthesis flux

    • Integration with computational models of bacterial metabolism

Research Priority Matrix:

Knowledge GapTechnical ApproachExpected Impact
Precise catalytic mechanismStructural studies combined with directed mutagenesisEnable rational design of UbiB variants with enhanced activity
Protein interaction networkProximity labeling proteomics (BioID, APEX)Identify previously unknown functional connections
In vivo dynamicsFluorescent protein fusions with super-resolution imagingUnderstand spatial and temporal regulation
Metabolic integrationSystems biology approaches with multi-omics integrationReveal how UbiB function coordinates with broader cellular metabolism

Addressing these knowledge gaps through methodological innovations would significantly advance our understanding of UbiB function and expand its potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.