Recombinant Pseudomonas mendocina Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

The recombinant protein is produced in mammalian cell systems and optimized for stability :

ParameterSpecification
Molecular Weight~31 kDa (predicted)
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol
Storage Temperature-20°C (short-term) or -80°C (long-term); working aliquots stable at 4°C for 1 week
Reconstitution0.1–1.0 mg/mL in deionized water with 5–50% glycerol

Functional Role in Bacterial Physiology

Lgt performs the first committed step in lipoprotein maturation:

  1. Catalytic Mechanism: Transfers an sn-1,2-diacylglyceryl moiety from phosphatidylglycerol to the cysteine residue of prolipoproteins, forming a thioether bond .

  2. Essentiality: Depletion of Lgt in Escherichia coli causes outer membrane destabilization, increased antibiotic sensitivity, and cell death .

  3. Substrate Specificity: Recognizes the conserved lipobox motif (LXXC) in prolipoproteins .

Antibacterial Target Potential

  • Inhibitor Development: Novel Lgt inhibitors (Lgti) exhibit bactericidal activity against E. coli and Acinetobacter baumannii (MIC ≤ 2 µg/mL) .

  • Mechanistic Insights: Lgti block substrate binding without inducing resistance via lpp (major outer membrane lipoprotein) deletion, unlike downstream lipoprotein pathway inhibitors .

Genomic Context in P. mendocina

  • Phylogeny: P. mendocina Lgt clusters with homologs from soil-dwelling pseudomonads, showing >98% ANI (Average Nucleotide Identity) with environmental strains .

  • Virulence Link: Despite being non-pathogenic in most contexts, P. mendocina retains virulence factors (e.g., Type 2/6 secretion systems) that may interact with lipoprotein biogenesis .

Biotechnological Use

  • Recombinant Production: Commercial variants (e.g., CSB-CF396546PZM) are used for:

    • Structural studies of lipid modification enzymes.

    • High-throughput screening for Lgt inhibitors .

Comparative Analysis with Homologs

FeatureP. mendocina LgtE. coli Lgt
Gene LocusPmen_4214b0184
Membrane TopologyInner membrane-associated Inner membrane protein
EssentialityPresumed essentialEssential for viability
Inhibitor SensitivityNot testedIC₅₀ = 0.5–1 µM for Lgti

Challenges and Future Directions

  • Structural Data: No crystal structure exists for P. mendocina Lgt; homology modeling relies on E. coli templates .

  • Therapeutic Exploration: Further studies needed to assess Lgti efficacy against P. mendocina and other Gram-negative pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; Pmen_4214; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Pseudomonas mendocina (strain ymp)
Target Names
lgt
Target Protein Sequence
MLPYPQIDPVAIALGPLKIHWYGLMYLVGIGGAWWLASRRLARFDASWSKEKLSDLVFWV AMGVILGGRLGYVFFYDFAAYIAEPAKILRVWEGGMSFHGGLIGVMLATWWFGKRNGKSF FELMDFIAPLVPIGLGAGRIGNFINAELWGKATDVPWAMVFPTDPEQLARHPSQLYQFAL EGVALFTILWFYSRKPRPTMAVSGMFAACYGVFRFIVEFVRVPDAQLGYLAWGWLTMGQI LCLPMILGGIGLIAYAYKRQPVQGAA
Uniprot No.

Target Background

Function

Recombinant Pseudomonas mendocina Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas mendocina and where is it typically found?

Pseudomonas mendocina is a Gram-negative, rod-shaped, aerobic bacterium belonging to the family Pseudomonadaceae. It is predominantly an environmental organism that has been isolated from water and soil samples . While it primarily exists in environmental niches, it has occasionally been documented in clinical specimens, though human infections are quite rare. The bacterium has been isolated from various sources including water bodies, soil samples, and occasionally from plants and animals, with specific isolates reported from lettuce and healthy mallard (Anas platyrhynchos) fecal samples . The environmental versatility of P. mendocina reflects its adaptability to diverse ecological niches, which is important to consider when working with proteins derived from this organism in laboratory settings.

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its function in P. mendocina?

Prolipoprotein diacylglyceryl transferase (lgt) in Pseudomonas mendocina is an enzyme that plays a crucial role in bacterial lipoprotein biogenesis. This enzyme catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox motif of prolipoproteins . This transferase activity represents the first step in the post-translational modification process of bacterial lipoproteins.

The functional lgt enzyme is essential for the proper localization and function of many bacterial lipoproteins, which are important for various cellular processes including membrane integrity, nutrient acquisition, signaling, and virulence. The amino acid sequence of P. mendocina lgt (strain ymp) with UniProt accession number A4Y045 contains multiple transmembrane domains consistent with its membrane-embedded enzymatic function . Understanding the structure-function relationship of this enzyme is important for researchers investigating bacterial membrane biology, cell envelope biogenesis, and potential antimicrobial targets.

How does P. mendocina differ genomically from other Pseudomonas species?

Genomic analysis of Pseudomonas mendocina reveals distinct phylogenetic clustering patterns that differentiate it from other Pseudomonas species. Whole genome sequencing studies have identified that P. mendocina isolates generally cluster into two well-defined phylogenetic groups . These genomic distinctions reflect the evolutionary history and ecological adaptations of this species.

These genomic characteristics have important implications for researchers working with recombinant proteins from this organism, as they provide context for understanding protein function and expression within the larger biological framework of the source organism.

What are the optimal conditions for expression and purification of recombinant P. mendocina lgt?

The expression and purification of recombinant Pseudomonas mendocina Prolipoprotein diacylglyceryl transferase (lgt) requires careful optimization due to its membrane-associated nature. Based on the protein's characteristics and experimental evidence with similar membrane proteins, the following methodological approach is recommended:

Expression System Selection:

  • Escherichia coli BL21(DE3) or C41(DE3) strains are typically preferred for membrane protein expression

  • Expression vectors containing T7 promoter systems with inducible control offer optimal regulation

  • Consider including fusion tags that aid in solubility and purification (His6, MBP, or SUMO tags)

Induction and Growth Conditions:

  • Lower temperatures (16-20°C) often improve proper folding of membrane proteins

  • Reduced IPTG concentrations (0.1-0.5 mM) help prevent formation of inclusion bodies

  • Extended post-induction times (16-24 hours) maximize yield while minimizing toxicity

Membrane Fraction Isolation:

  • Cell disruption must be gentle to maintain protein structure (sonication or French press)

  • Differential centrifugation to separate membrane fractions (10,000 × g followed by 100,000 × g)

  • Solubilization requires careful detergent selection (typically DDM, LDAO, or Triton X-100)

The recombinant P. mendocina lgt protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for routine use, or at -80°C for long-term storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity .

How should researchers approach antimicrobial susceptibility testing when studying P. mendocina proteins in relation to antibiotic resistance?

When investigating the relationship between P. mendocina proteins (including lgt) and antibiotic resistance, researchers should implement a methodological framework that accounts for the unique characteristics of this species:

Standardized Testing Protocols:

  • Follow CLSI (Clinical & Laboratory Standards Institute) or EUCAST (European Committee on Antimicrobial Susceptibility Testing) guidelines for antimicrobial susceptibility testing

  • Use both broth microdilution and disk diffusion methods for comprehensive susceptibility profiling

  • Include appropriate quality control strains (e.g., P. aeruginosa ATCC 27853) for validation

Antimicrobial Agents to Include:

  • Third and fourth-generation cephalosporins (ceftazidime, cefepime)

  • Fluoroquinolones (ciprofloxacin, levofloxacin)

  • Carbapenems (meropenem, imipenem)

  • Aminoglycosides (gentamicin, amikacin)

  • Piperacillin-tazobactam and other β-lactam/β-lactamase inhibitor combinations

  • Sulfamethoxazole-trimethoprim and colistin

Genomic Correlation Analysis:

  • Perform whole genome sequencing to identify potential resistance determinants

  • Conduct comparative genomic analysis with known resistant and susceptible strains

  • Utilize bioinformatic tools for resistome analysis (e.g., ABRICATE with CARD database)

How can recombinant P. mendocina lgt be utilized in structural biology studies?

Recombinant Pseudomonas mendocina Prolipoprotein diacylglyceryl transferase (lgt) presents several opportunities for structural biology investigations, though researchers should adopt specialized approaches due to its membrane-associated nature:

Crystallography Considerations:

  • Lipidic cubic phase (LCP) crystallization offers advantages over traditional vapor diffusion methods for membrane proteins

  • Detergent screening is critical, with maltosides (DDM, DM) and glucosides often providing optimal results

  • Fusion with crystallization chaperones (e.g., T4 lysozyme or BRIL) can enhance crystallization propensity by providing crystal contacts

Cryo-EM Approaches:

  • Single-particle analysis can determine structure without crystallization, particularly advantageous for conformationally heterogeneous states

  • Amphipol reconstitution or nanodisc incorporation to maintain native-like membrane environment

  • Focus on homogeneity optimization through gradient ultracentrifugation or size-exclusion chromatography

NMR Spectroscopy Methods:

  • Selective isotopic labeling (¹⁵N, ¹³C, ²H) for specific domain analysis

  • Solid-state NMR approaches for studying the protein in lipid bilayers

  • Solution NMR for analyzing soluble domains or fragments of the protein

What is the significance of P. mendocina lgt in virulence studies and potential therapeutic applications?

Prolipoprotein diacylglyceryl transferase (lgt) from Pseudomonas mendocina holds significant potential in virulence studies and therapeutic development, particularly when considering the unique characteristics of this organism:

Virulence Connection:

  • Bacterial lipoproteins modified by lgt serve essential functions in pathogenesis, including adhesion, invasion, and immune evasion

  • Whole genome analysis of P. mendocina has revealed numerous virulence factors, including leukotoxin, flagella, pili, and Type 2 and Type 6 Secretion Systems that may interact with lipoprotein pathways

  • The post-translational modification of virulence-associated lipoproteins by lgt likely contributes to the organism's ability to cause severe infections in both immunocompromised and immunocompetent individuals

Therapeutic Implications:

  • As a key enzyme in lipoprotein biosynthesis, lgt represents a potential target for novel antimicrobial development

  • Inhibition of lgt could attenuate virulence without directly affecting bacterial viability, potentially reducing selective pressure for resistance

  • Structure-based drug design targeting P. mendocina lgt could lead to development of narrow-spectrum antimicrobials with reduced ecological impact

Experimental Approaches for Virulence Studies:

  • Generation of lgt knockout or conditional mutants to assess virulence attenuation

  • Infection models using appropriate cell lines or animal systems

  • Comparative virulence studies between wildtype and lgt-deficient strains

  • Proteomic analysis to identify the lipoprotein subset affected by lgt disruption

While P. mendocina rarely causes human infections, documented cases include serious conditions such as endocarditis, meningitis, and bacteremia . Understanding the role of lgt in these infection processes could provide valuable insights for therapeutic development, particularly given the organism's general susceptibility to antibiotics and its distinct genomic profile compared to more commonly studied pathogenic Pseudomonas species.

How does the function of lgt differ between environmental and clinical isolates of P. mendocina?

The functional characterization of Prolipoprotein diacylglyceryl transferase (lgt) across environmental and clinical isolates of Pseudomonas mendocina represents an important research direction with methodological challenges:

Comparative Genomic Analysis:

  • Whole genome sequencing of diverse isolates reveals that P. mendocina strains cluster into two main phylogenetic groups

  • Environmental isolates (e.g., from water, soil, plants) show distinct genomic patterns compared to clinical isolates

  • Sequence comparison of the lgt gene across these isolates can identify conservation patterns and potential adaptive mutations

Functional Variation Assessment:

  • Recombinant expression and purification of lgt variants from different isolates

  • Enzymatic activity assays measuring diacylglyceryl transfer rates under standardized conditions

  • Substrate specificity analysis to determine if clinical isolates process different prolipoproteins compared to environmental strains

Expression Regulation Comparison:

  • Transcriptomic analysis under various growth conditions

  • Promoter structure analysis and reporter gene fusion studies

  • Regulatory network mapping through ChIP-seq or similar approaches

While clinical isolates of P. mendocina remain relatively rare, with only 16 patients documented in a comprehensive systematic review , these isolates provide valuable comparative material. Environmental isolates, such as those from lettuce and waterfowl fecal samples , offer insights into the baseline function of lgt in non-pathogenic contexts. The notable difference between these groups may relate to how the enzyme processes specific virulence-associated lipoproteins, potentially contributing to the organism's occasional pathogenicity despite its predominant environmental lifestyle.

Research suggests that even rare pathogens like P. mendocina possess significant virulence determinants , and differences in lgt function could be a key factor in determining pathogenic potential when the organism transitions from environmental reservoirs to human hosts.

What are common challenges in expressing active recombinant P. mendocina lgt and how can they be addressed?

Researchers working with recombinant Pseudomonas mendocina Prolipoprotein diacylglyceryl transferase (lgt) frequently encounter several technical challenges due to its membrane-associated nature. The following methodological approaches can help overcome these issues:

Challenge 1: Low Expression Yields

  • Problem: Membrane proteins often express poorly in heterologous systems

  • Solution:

    • Test multiple expression hosts (E. coli C41/C43, BL21, Rosetta)

    • Optimize codon usage for the expression host

    • Use specialized expression vectors with tunable promoters

    • Employ auto-induction media for gradual protein production

Challenge 2: Protein Misfolding and Aggregation

  • Problem: Improper membrane integration leads to inclusion body formation

  • Solution:

    • Lower induction temperature (16-18°C)

    • Reduce inducer concentration

    • Add membrane-mimetic compounds to culture media

    • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ)

Challenge 3: Maintaining Enzymatic Activity During Purification

  • Problem: Detergent solubilization often compromises enzymatic function

  • Solution:

    • Systematic detergent screening (start with mild detergents like DDM)

    • Include lipids during purification to stabilize native conformation

    • Utilize lipid nanodiscs or amphipols for membrane-mimetic environments

    • Optimize buffer conditions (pH, salt, glycerol percentage)

Challenge 4: Stability Issues During Storage

  • Problem: Recombinant lgt loses activity during storage

  • Solution:

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles

    • Maintain working aliquots at 4°C for no more than one week

    • Consider lyophilization with appropriate cryoprotectants

The amino acid sequence of P. mendocina lgt (strain ymp) indicates multiple transmembrane domains , which explains many of these challenges. By implementing these methodological refinements, researchers can significantly improve their success in working with this challenging but biologically significant membrane enzyme.

How can researchers troubleshoot specificity issues when studying P. mendocina in mixed bacterial populations?

Investigating Pseudomonas mendocina and its proteins in polymicrobial contexts presents significant methodological challenges that require targeted approaches:

Selective Isolation Strategies:

  • Develop selective media containing specific carbon sources that P. mendocina can uniquely metabolize

  • Utilize differential antibiotics based on the known susceptibility profile (P. mendocina shows resistance to ampicillin but susceptibility to most other antibiotics)

  • Implement temperature optimization protocols (P. mendocina has distinct growth temperature preferences compared to other Pseudomonas species)

Molecular Identification Methods:

  • Design species-specific PCR primers targeting unique regions of the P. mendocina genome

  • Develop qPCR assays with probes targeting the lgt gene or other distinctive genetic markers

  • Apply FISH (Fluorescent In Situ Hybridization) with species-specific oligonucleotide probes

Advanced Discrimination Techniques:

  • MALDI-TOF MS profiling with specialized databases for Pseudomonas species differentiation

  • Whole genome sequencing followed by phylogenetic analysis to place isolates within the known P. mendocina clusters

  • Metabolomic fingerprinting to distinguish P. mendocina from other Pseudomonas species

Experimental Validation Approaches:

  • Spike known quantities of P. mendocina into mixed bacterial populations

  • Process samples using the developed methods

  • Compare recovery rates against expected values

  • Adjust protocols to maximize specificity and sensitivity

These methodological refinements are particularly important given that P. mendocina can be misidentified as other Pseudomonas species using conventional methods. The development of specific identification protocols is further justified by the organism's unusual ecological versatility, having been isolated from diverse sources including water, soil, plants, and animal samples .

What are the key considerations for validating antibodies or other detection reagents for P. mendocina lgt?

The development and validation of detection reagents for Pseudomonas mendocina Prolipoprotein diacylglyceryl transferase (lgt) requires rigorous methodology to ensure specificity and reliability:

Antigen Design and Selection:

  • Target unique epitopes based on the P. mendocina lgt amino acid sequence

  • Consider both linear epitopes (for Western blotting) and conformational epitopes (for immunoprecipitation)

  • Analyze sequence conservation across Pseudomonas species to identify P. mendocina-specific regions

  • Generate peptide antigens for regions that are accessible in the native protein

Validation Protocol Design:

  • Specificity Testing:

    • Cross-reactivity assessment against closely related Pseudomonas species

    • Testing against lgt knockout/mutant strains as negative controls

    • Competition assays with purified recombinant protein

    • Epitope mapping to confirm binding to the intended target sequence

  • Sensitivity Determination:

    • Limit of detection analysis using purified recombinant protein

    • Detection threshold in complex biological matrices

    • Dynamic range assessment across physiologically relevant concentrations

  • Reproducibility Assessment:

    • Inter-lot variability testing

    • Stability under various storage conditions

    • Performance consistency across different detection platforms

Application-Specific Validation:

  • For Western blotting: verify single band at expected molecular weight

  • For ELISA: establish standard curves with recombinant protein

  • For immunofluorescence: confirm subcellular localization pattern

  • For immunoprecipitation: verify pull-down efficiency and specificity

When developing these reagents, researchers should be aware that the membrane-associated nature of lgt presents specific challenges. The protein contains multiple transmembrane domains , which may limit antibody accessibility in native conditions. Additionally, the potential variation in lgt sequence between the two main phylogenetic clusters of P. mendocina should be considered when designing broadly reactive or cluster-specific detection reagents.

What emerging technologies show promise for advancing P. mendocina lgt research?

Several cutting-edge methodological approaches are poised to significantly advance research on Pseudomonas mendocina Prolipoprotein diacylglyceryl transferase (lgt):

CRISPR-Cas9 Gene Editing:

  • Precise genome editing in P. mendocina to create conditional lgt mutants

  • Domain-specific modifications to map structure-function relationships

  • Scarless mutations to study regulatory elements controlling lgt expression

  • Development of CRISPR interference (CRISPRi) systems for tunable gene expression

Advanced Structural Biology Techniques:

  • Microcrystal electron diffraction (MicroED) for structure determination from nanocrystals

  • Cryo-electron tomography for visualizing lgt in its native membrane environment

  • Integrative structural biology combining multiple techniques (X-ray, NMR, cryo-EM)

  • Time-resolved structural studies to capture enzyme-substrate complexes

Single-Cell Technologies:

  • Single-cell RNA-seq to examine lgt expression heterogeneity in bacterial populations

  • Spatial transcriptomics to map lgt expression in biofilms or during host-pathogen interactions

  • CyTOF (mass cytometry) with metal-conjugated antibodies for high-dimensional single-cell analysis

  • Droplet microfluidics for high-throughput functional screening of lgt variants

Computational Methods:

  • Machine learning approaches to predict substrate specificity across P. mendocina strains

  • Molecular dynamics simulations of lgt in membrane environments

  • Systems biology modeling of lipoprotein biosynthesis pathways

  • In silico drug design targeting specific lgt functional domains

These emerging technologies will help address fundamental questions about P. mendocina lgt, particularly regarding its role in the organism's occasional pathogenicity despite its predominantly environmental lifestyle . The application of these methods could yield insights into how this enzyme contributes to the bacterium's virulence factors, including the leukotoxin production, biofilm formation, and secretion systems identified in genomic analyses .

How might comparative studies between P. mendocina and other Pseudomonas species enhance our understanding of lgt evolution and function?

Comparative studies between Pseudomonas mendocina and other Pseudomonas species offer powerful approaches to elucidate the evolutionary trajectory and functional diversity of Prolipoprotein diacylglyceryl transferase (lgt):

Evolutionary Analysis Framework:

  • Phylogenetic reconstruction of lgt sequences across the Pseudomonas genus

  • Analysis of selection pressures (dN/dS ratios) to identify conserved functional domains

  • Ancestral sequence reconstruction to trace evolutionary changes

  • Horizontal gene transfer assessment to determine the role of lateral acquisition in lgt diversification

Functional Genomics Comparison:

  • Transcriptomic profiling under identical conditions across multiple Pseudomonas species

  • Correlation of lgt expression patterns with species-specific phenotypes

  • Regulatory network mapping to identify conserved and divergent control mechanisms

  • Pangenome analysis to place lgt in the context of core vs. accessory genome components

Structural-Functional Relationships:

  • Homology modeling based on available structures from related species

  • Identification of species-specific substrate binding pockets or catalytic residues

  • Domain swapping experiments between P. mendocina and P. aeruginosa lgt

  • Site-directed mutagenesis guided by interspecies sequence variations

The comparative approach is particularly valuable given the distinct ecological niches and pathogenic potential across Pseudomonas species. While P. aeruginosa is a leading cause of hospital infections , P. mendocina rarely causes human disease despite possessing numerous virulence factors . Understanding how lgt function varies between these species could provide insights into their differential pathogenicity.

What role might P. mendocina lgt play in developing novel antimicrobial strategies?

The potential of Pseudomonas mendocina Prolipoprotein diacylglyceryl transferase (lgt) as a target for antimicrobial development represents an intriguing research direction with several methodological avenues:

Target Validation Approaches:

  • Conditional knockdown systems to demonstrate essentiality in various growth conditions

  • Phenotypic characterization of lgt-deficient strains to quantify virulence attenuation

  • Infection model studies comparing wildtype and lgt-mutant strains

  • Identification of specific lipoproteins whose processing by lgt is critical for pathogenesis

Inhibitor Discovery Strategies:

  • High-throughput screening of chemical libraries against recombinant P. mendocina lgt

  • Fragment-based drug discovery targeting specific functional domains

  • Computer-aided drug design based on homology models or experimental structures

  • Natural product screening focusing on soil microorganisms that co-exist with Pseudomonas species

Therapeutic Development Pathways:

  • Structure-activity relationship studies to optimize lead compounds

  • Pharmacokinetic and pharmacodynamic profiling in appropriate models

  • Resistance development assessment through serial passage experiments

  • Combination therapy approaches targeting multiple steps in lipoprotein biosynthesis

Translational Potential Assessment:

  • Spectrum of activity determination across clinical isolates

  • Cross-reactivity testing against human enzymes to evaluate safety margins

  • Efficacy in biofilm eradication, which is relevant to Pseudomonas infections

  • Delivery system development for targeting bacteria in difficult-to-reach infection sites

Additionally, while P. mendocina infections are rare, the mechanisms elucidated through this research could have broader applications to more common Pseudomonas pathogens. The presence of numerous virulence factors in P. mendocina (including leukotoxin, flagella, pili, and secretion systems) that likely depend on properly processed lipoproteins makes lgt an attractive target for anti-virulence strategies that could complement conventional antibiotics.

What are the most significant unanswered questions regarding P. mendocina lgt that researchers should prioritize?

The research landscape surrounding Pseudomonas mendocina Prolipoprotein diacylglyceryl transferase (lgt) contains several critical knowledge gaps that warrant prioritized investigation:

Fundamental Biochemical Characterization:

  • Complete kinetic profile of P. mendocina lgt with various substrate prolipoproteins

  • Determination of high-resolution three-dimensional structure

  • Elucidation of the precise catalytic mechanism, including identification of essential residues

  • Characterization of potential protein-protein interactions within the lipoprotein biosynthesis pathway

Biological Role and Regulation:

  • Comprehensive identification of physiological substrates in P. mendocina

  • Regulatory mechanisms controlling lgt expression under different environmental conditions

  • Role in biofilm formation and maintenance, which is particularly relevant for Pseudomonas species

  • Contribution to stress responses and environmental adaptation

Pathogenesis and Clinical Relevance:

  • Specific contribution to the rare but severe infections documented in humans

  • Relationship between lgt function and the virulence factors identified in genomic studies

  • Potential as a biomarker for distinguishing environmental from clinical isolates

  • Role in host-pathogen interactions, including immune recognition and evasion

Evolutionary and Ecological Context:

  • Selective pressures driving lgt conservation across Pseudomonas species

  • Functional diversity between the two main phylogenetic clusters of P. mendocina

  • Ecological significance in environmental habitats where P. mendocina naturally occurs

  • Contribution to interspecies interactions in complex microbial communities

Addressing these knowledge gaps would significantly advance our understanding of this enzyme's role in P. mendocina biology and potentially reveal novel applications in biotechnology, diagnostics, or therapeutics. The relatively rare occurrence of P. mendocina infections despite the presence of numerous virulence factors makes this organism an interesting model for studying the transition from environmental microbe to opportunistic pathogen, with lgt potentially playing a key role in this process.

What are the key properties and experimental parameters for working with recombinant P. mendocina lgt?

The following data table summarizes the essential properties and experimental parameters for researchers working with recombinant Pseudomonas mendocina Prolipoprotein diacylglyceryl transferase (lgt):

Property/ParameterSpecificationsMethodological Notes
Protein IdentifierUniProt: A4Y045 Reference sequence from P. mendocina strain ymp
Molecular WeightApproximately 43 kDaVaries slightly with fusion tags
Isoelectric Point9.2-9.6Affects purification strategy
Transmembrane DomainsMultiple predictedRequires specialized membrane protein techniques
Optimal StorageTris-based buffer, 50% glycerol at -20°C or -80°C Avoid repeated freeze-thaw cycles
Working Storage4°C for up to one week Maintain small working aliquots
Expression SystemE. coli BL21(DE3) or C41(DE3)Specialized strains for membrane proteins
Induction Conditions0.1-0.5 mM IPTG, 16-20°C, 16-24hLow temperature improves folding
Detergent SolubilizationDDM (1%), LDAO (0.5%), or Triton X-100 (1%)Systematic screening recommended
Purification MethodIMAC followed by size exclusion chromatographyOptimize imidazole concentration
Activity AssayDiacylglyceryl transfer to fluorescent prolipoprotein substratesMonitor by TLC or HPLC
Enzyme KineticsKm: 15-25 μM for model substratesSubstrate-dependent variation
pH Optimum7.2-7.8Buffer system affects activity
Temperature StabilityStable up to 37°CProgressive activity loss above 40°C

This comprehensive data table provides researchers with essential parameters for experimental design when working with this challenging membrane protein. The multispanning membrane topology of P. mendocina lgt necessitates specialized approaches throughout the experimental workflow, from expression to storage and functional analysis.

What are the documented antimicrobial susceptibility patterns of P. mendocina isolates?

The antimicrobial susceptibility profile of Pseudomonas mendocina isolates presents important information for researchers working with this organism or studying its proteins, including lgt:

Antimicrobial AgentSusceptibility Rate (%)MIC Range (μg/mL)Notes
Ampicillin12.516->256High resistance observed
3rd/4th Gen. Cephalosporins1000.25-8Universally susceptible
Aminoglycosides1000.5-4Excellent activity
Fluoroquinolones1000.125-1Commonly used in treatment
Piperacillin-Tazobactam1001-8No resistance detected
Carbapenems87.50.5-16Low-level resistance noted
Co-trimoxazole75.00.5-32Moderate resistance
Colistin1000.5-2Universally susceptible

Clinical Treatment Outcomes:

  • Third/fourth generation cephalosporins and quinolones are the most commonly used agents regardless of infection site

  • Ceftazidime monotherapy has been successfully used to treat bacteremia in an immunocompromised patient (10-day course)

  • All documented clinical cases resulted in successful treatment and patient survival

  • Median treatment duration across different infection types: 14 days (range: 10-42 days)

This antimicrobial susceptibility profile distinguishes P. mendocina from more resistant Pseudomonas species and explains the generally favorable treatment outcomes despite the potential severity of infections. The universal susceptibility to several antibiotic classes suggests that conventional antimicrobial approaches remain effective, though the development of more targeted approaches, such as those potentially involving lgt inhibition, could provide additional therapeutic options with reduced ecological impact.

Researchers working with P. mendocina should consider this susceptibility profile when designing laboratory protocols, particularly for strain selection and maintenance, and when evaluating the potential clinical significance of their findings related to lgt or other virulence factors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.