Recombinant Pseudomonas mendocina Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Molecular Overview and Production

Recombinant HtpX is produced via heterologous expression in Escherichia coli, typically fused with an N-terminal His-tag for purification purposes. This construct includes the full-length protein (1–290 amino acids) encoded by the htpX gene (UniProt ID: A4XVB4 for P. mendocina strain ymp) .

ParameterValue
SpeciesPseudomonas mendocina (strain ymp)
SourceE. coli (recombinant expression)
TagN-terminal His-tag
Molecular Weight~32.5 kDa (estimated from AA sequence)
Storage BufferTris-based buffer with 50% glycerol
Purity>90% (SDS-PAGE verified)

Primary Sequence

The amino acid sequence of P. mendocina HtpX (PA2830 ortholog) reveals conserved motifs typical of heat shock proteases, including a catalytic domain and substrate-binding regions. Key residues include glycine-rich regions (e.g., GXXXG motifs) and hydrophobic clusters critical for structural stability .

Amino Acid Sequence (Partial):
MMRImLFLATNLAVLIIASITLKLLGVDRFTGQNHGSLLIFCAVFGFAGSLVSLFISKWM AKMSTGTQIITQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYESNAFATGWNKNDAL VAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIFGSFVDKA

Protease Activity

HtpX is annotated as a heat shock protease (EC 3.4.24.-) with potential roles in protein quality control under stress conditions. Its activity is linked to stress response pathways, including heat shock and antibiotic resistance . In Pseudomonas species, similar HtpX homologs are implicated in:

  • Protein degradation: Regulation of misfolded or damaged proteins .

  • Antibiotic resistance: Modulation of efflux pumps or stress response systems .

Stress Response and Metabolic Regulation

HtpX is induced under heat shock and other stress conditions, suggesting a role in maintaining cellular homeostasis. In Pseudomonas species, heat shock proteases like HtpX may interact with chaperones (e.g., DnaK/DnaJ) to refold proteins or degrade aggregated substrates .

Industrial and Biotechnological Uses

  • Fine chemical production: Overexpression of HtpX or its homologs in E. coli or plants enhances methionine biosynthesis by reducing proteolytic degradation of key enzymes .

  • Recombinant protein optimization: Modulating protease activity (e.g., HtpX) can improve yields of soluble recombinant proteins by minimizing proteolysis during expression .

Pathogenicity and Virulence

While P. mendocina is not a primary pathogen, its genomes encode virulence factors, including proteases. HtpX’s protease activity may contribute to:

  • Host-cell interactions: Potential roles in degrading host proteins or evading immune responses .

  • Antibiotic resistance: Synergy with efflux pumps (e.g., TetR/AcrR family) to counteract antimicrobial stress .

Key Experimental Insights

  • HtpX in Methionine Production: Overexpression of HtpX in E. coli or plants increases free methionine levels by stabilizing methionine biosynthetic enzymes .

  • Protease Modulation: Deletion of HtpX homologs (e.g., HslU in Pseudomonas fluorescens) improves recombinant protein solubility, highlighting its role in proteolysis .

Unanswered Questions

  • Mechanistic Role in P. mendocina: Direct evidence linking HtpX to stress response or pathogenicity in P. mendocina remains limited.

  • Substrate Specificity: The catalytic targets of HtpX in vivo are not fully characterized.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format preference, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors such as storage conditions, buffer components, temperature, and inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
htpX; Pmen_2524; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Pseudomonas mendocina (strain ymp)
Target Names
htpX
Target Protein Sequence
MMRIMLFLATNLAVLIIASITLKLLGVDRFTGQNHGSLLIFCAVFGFAGSLVSLFISKWM AKMSTGTQIITQPRTRHEQWLLQTVEELSREAGIKMPEVGIFPAYESNAFATGWNKNDAL VAVSQGLLERFSPDEVRAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIFGSFVDKA IFKNEDGHGIGYFIATIFAELVLGILASIIVMWFSRKREFKADEAGARLAGTGAMIAALQ RLRAEQGVPVQMPDSLTAFGINGGLKNGLAGLLMTHPPLEDRIEALRRLG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas mendocina Protease HtpX?

Protease HtpX is a zinc-dependent membrane metalloprotease classified under EC 3.4.24.- (an endopeptidase). It is encoded by the htpX gene in Pseudomonas mendocina, a Gram-negative, aerobic, rod-shaped bacterium belonging to the family Pseudomonadaceae. P. mendocina is naturally found in water and soil samples and rarely causes human infections . The HtpX protease functions as a heat shock protein involved in protein quality control within the bacterial membrane, particularly in the degradation of misfolded membrane proteins. The full-length protein consists of 290 amino acids and contains characteristic metalloprotease domains essential for its catalytic activity .

What are the known structural features of P. mendocina HtpX?

P. mendocina Protease HtpX is a membrane-bound metalloprotease with multiple transmembrane segments. Key structural features include:

  • Transmembrane domains: The protein contains multiple hydrophobic segments that anchor it to the bacterial membrane

  • Catalytic domain: Contains the metalloprotease active site with zinc-binding motifs

  • N-terminal region: Contains targeting sequences for membrane integration

  • Expression region: The functional expression region spans positions 1-290 of the amino acid sequence

While detailed crystallographic data specifically for P. mendocina HtpX is limited, structural predictions based on homology with other bacterial HtpX proteases suggest a conserved zinc-binding domain essential for its proteolytic activity.

How can the htpX gene be cloned and expressed in heterologous systems?

Based on experimental evidence, the following methodology has proven effective for cloning and expressing the htpX gene:

  • Gene amplification: Design primers containing appropriate restriction endonuclease sites (such as BamHI and SmaI) based on the htpX gene sequence. For P. mendocina, primers have been successfully designed as:

    • Forward primer: 5′-CGGATCCTGCTGCTAAAACATTCACTGTT-3′

    • Reverse primer: 5′-TCCCCGGGTTTATAGGAATGCAAGCGC-3′

  • PCR amplification: Using genomic DNA of P. mendocina as a template, amplify the htpX gene via PCR.

  • Vector selection and preparation: Digest an appropriate expression vector (such as pHT43) with the same restriction enzymes used in the primer design.

  • Ligation and transformation: Treat the PCR product and prepared vector with T4 ligase, then transform into a suitable host such as E. coli DH5α for plasmid propagation.

  • Validation: Confirm successful cloning by bacterial PCR and sequencing.

  • Expression host transformation: Transform the validated recombinant plasmid into an expression host such as E. coli BL21(DE3) or Bacillus subtilis WB800N.

  • Induction: Culture the transformed expression host to mid-log phase (OD600 ≈ 0.6–0.8) and induce protein expression with an appropriate inducer (e.g., IPTG at 1 mM final concentration) .

What expression systems provide optimal yields for recombinant HtpX?

Multiple expression systems have been utilized for recombinant HtpX production, each with distinct advantages:

  • E. coli BL21(DE3): This system is widely used for initial cloning and expression due to its:

    • High transformation efficiency

    • Rapid growth rate

    • Well-established induction systems

    • Compatibility with various vectors

  • Bacillus subtilis WB800N: This system has demonstrated success for HtpX expression, particularly beneficial because:

    • It lacks eight extracellular proteases, reducing protein degradation

    • Provides a gram-positive cellular environment

    • Offers efficient secretion of proteins when used with appropriate secretion signals

    • Has been specifically documented in successful HtpX expression studies

The optimal system selection depends on research objectives, with E. coli systems typically preferred for analytical studies and B. subtilis potentially offering advantages for larger-scale production or when studying proteases in environments more similar to the native host.

What purification strategies yield the highest purity recombinant HtpX?

For optimal purification of recombinant P. mendocina HtpX protease, a multi-step purification strategy is recommended:

  • Initial clarification: After cell lysis, centrifuge at high speed (typically 10,000-15,000 × g) to remove cellular debris.

  • Affinity chromatography: If the recombinant protein contains an affinity tag (which is commonly determined during the production process ), use the appropriate affinity resin:

    • His-tagged proteins: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins

    • GST-tagged proteins: Glutathione sepharose

    • MBP-tagged proteins: Amylose resin

  • Ion exchange chromatography: As a secondary purification step, based on the theoretical pI of HtpX.

  • Size exclusion chromatography: As a final polishing step to remove aggregates and achieve high purity.

For membrane-bound proteases like HtpX, additional considerations include:

  • Inclusion of appropriate detergents during purification to maintain solubility

  • Careful buffer optimization to preserve enzymatic activity

  • Temperature control throughout the purification process

What are the optimal conditions for measuring HtpX proteolytic activity?

The optimal conditions for assaying P. mendocina HtpX proteolytic activity include:

  • Buffer composition:

    • Tris-based buffer systems at pH 7.5-8.0

    • Presence of zinc or other divalent cations as cofactors

    • Addition of reducing agents (e.g., DTT at 1-5 mM) to maintain cysteine residues

  • Temperature conditions:

    • Typically assayed at 30-37°C for standard activity

    • For thermostability studies, temperatures up to 45°C may be relevant

  • Substrate selection:

    • Fluorogenic peptide substrates containing HtpX recognition sequences

    • Model membrane proteins for physiologically relevant substrates

    • Synthetic peptides derived from known cellular substrates

  • Detection methods:

    • Continuous fluorometric assays for real-time monitoring

    • SDS-PAGE analysis for larger protein substrates

    • HPLC-based peptide mapping for cleavage site determination

  • Controls:

    • Heat-inactivated enzyme as negative control

    • Known active metalloproteases as positive controls

    • Inclusion of EDTA to confirm metal-dependency

While conducting activity assays, storage in an optimized buffer (typically Tris-based with 50% glycerol) at -20°C helps maintain enzyme stability between experiments .

How does substrate specificity of HtpX compare with other bacterial proteases?

HtpX belongs to the zinc-dependent metalloprotease family but shows distinct substrate preferences compared to other bacterial proteases:

Protease TypePreferred SubstratesCleavage SpecificityInhibitor SensitivityCellular Localization
HtpXMisfolded membrane proteinsHydrophobic residuesZinc chelators (EDTA)Membrane-bound
Pseudomonas ElastaseElastin, caseinHydrophobic amino acidsPhosphoramidonExtracellular
Subtilisin-likeVarious proteinsBroad specificityPMSFExtracellular
Lon ProteaseMisfolded cytoplasmic proteinsATP-dependentDiisopropyl fluorophosphateCytoplasmic

P. mendocina HtpX demonstrates specificity for membrane-integrated substrates, particularly those with exposed hydrophobic regions, which distinguishes it from many other bacterial proteases that primarily act on soluble proteins. This substrate specificity is critical for its biological role in membrane protein quality control.

How can site-directed mutagenesis be employed to study HtpX function?

Site-directed mutagenesis represents a powerful approach for elucidating structure-function relationships in P. mendocina HtpX protease:

  • Key target residues for mutagenesis:

    • Zinc-binding motifs (typically HEXXH) within the catalytic domain

    • Conserved residues in substrate binding pockets

    • Transmembrane anchor residues to study membrane integration

    • Interface residues potentially involved in oligomerization

  • Experimental methodology:

    • Design mutagenic primers with desired nucleotide changes

    • Perform PCR-based mutagenesis using a template containing the wild-type htpX gene

    • Transform the mutated constructs into an appropriate expression system like E. coli BL21(DE3) or B. subtilis WB800N

    • Express and purify the mutant proteins using protocols established for wild-type HtpX

    • Compare enzymatic parameters and structural properties between wild-type and mutant proteins

  • Functional characterization of mutants:

    • Measure changes in proteolytic activity using standardized assays

    • Assess alterations in substrate specificity

    • Determine impacts on thermostability and pH optimum

    • Analyze effects on membrane integration and localization

This approach has been successfully employed with related metalloproteases and could reveal critical determinants of HtpX catalytic mechanism, substrate recognition, and regulation.

What experimental approaches can determine HtpX substrate specificity in vivo?

Understanding the physiological substrates of P. mendocina HtpX requires specialized experimental approaches:

  • Proteomic identification of substrates:

    • Comparative proteomics between wild-type and htpX knockout strains

    • Stable isotope labeling with amino acids in cell culture (SILAC) to quantify protein turnover rates

    • Targeted protein degradation assays using candidate membrane protein substrates

  • Genetic approaches:

    • Construction of isogenic htpX knockout mutants (similar to approaches used for phaC1 and phaC2 knock-out studies in P. mendocina)

    • Complementation studies with wild-type and mutant htpX variants

    • Synthetic lethality screens to identify genetic interactions

  • Substrate trapping approaches:

    • Generation of catalytically inactive HtpX variants that bind but don't cleave substrates

    • Co-immunoprecipitation coupled with mass spectrometry to identify interacting proteins

    • In vivo crosslinking to capture transient enzyme-substrate complexes

  • Bioinformatic prediction:

    • Analysis of membrane proteomes for potential cleavage motifs

    • Structural modeling of substrate binding pockets

    • Evolutionary conservation analysis of substrate recognition regions

These approaches can complement each other to build a comprehensive understanding of HtpX's physiological role in P. mendocina.

What are the potential biotechnological applications of recombinant HtpX?

Recombinant P. mendocina HtpX protease presents several promising biotechnological applications:

  • Protein engineering tool:

    • Selective cleavage of fusion proteins containing specific recognition sequences

    • Removal of transmembrane domains from recombinant membrane proteins

    • Site-specific proteolytic processing in protein production pipelines

  • Bioremediation applications:

    • Degradation of persistent membrane-bound pollutants

    • Processing of recalcitrant protein contaminants in industrial waste streams

    • Component in enzymatic cocktails for biofilm degradation

  • Analytical applications:

    • Specialized reagent for membrane protein topology studies

    • Tool for probing membrane protein structure through limited proteolysis

    • Component in proteomic workflows targeting membrane proteins

  • Medical research:

    • Model system for studying bacterial stress responses

    • Target for developing antimicrobial strategies against Pseudomonas species

    • Tool for investigating membrane protein quality control mechanisms

While clinical applications would require extensive testing and validation, the unique substrate specificity of HtpX makes it particularly valuable for specialized applications involving membrane-integrated substrates.

How does the function of HtpX relate to bacterial stress response and virulence?

The role of HtpX in bacterial stress response and potential contributions to virulence can be analyzed through multiple research angles:

  • Stress response connections:

    • HtpX as a heat shock protein responds to temperature elevation and other stress conditions

    • Functions in quality control of membrane proteins under stress conditions

    • May participate in adaptation to changing environmental conditions

  • Relationship to virulence:

    • While P. mendocina rarely causes human infections, other Pseudomonas species are significant pathogens

    • P. mendocina has been documented in rare cases of bacteremia and meningitis

    • HtpX may contribute to survival within host environments by maintaining membrane integrity

  • Experimental approaches:

    • Comparative virulence studies between wild-type and htpX-deficient strains

    • Transcriptomic analysis of htpX expression during infection models

    • Assessment of contribution to antibiotic resistance phenotypes

  • Clinical relevance:

    • P. mendocina infections have been successfully treated with various antibiotics including ceftazidime, ceftriaxone, and fluoroquinolones

    • Understanding HtpX function could potentially inform new therapeutic approaches

AntibioticMIC (μg/mL)Susceptibility Status
Ceftazidime1-2Susceptible
Ciprofloxacin0.023-0.25Susceptible
Gentamicin0.25-2Susceptible
Meropenem0.125Susceptible
Piperacillin0.62Susceptible

Table: Antibiotic susceptibilities reported for P. mendocina clinical isolates

What are common challenges in obtaining active recombinant HtpX and their solutions?

Researchers often encounter several challenges when working with recombinant P. mendocina HtpX:

  • Expression challenges:

    • Problem: Low expression levels due to toxicity

    • Solution: Use tightly regulated expression systems, lower induction temperatures (16-25°C), or specialized host strains designed for toxic proteins

  • Solubility issues:

    • Problem: Formation of inclusion bodies due to hydrophobic transmembrane domains

    • Solution: Optimize induction conditions (lower IPTG concentration of 0.1-0.5 mM), co-express with chaperones, or use appropriate detergents during protein extraction

  • Purification difficulties:

    • Problem: Protein aggregation during purification

    • Solution: Include appropriate detergents (e.g., DDM, CHAPS) in purification buffers, maintain low temperatures throughout the process, and consider on-column refolding techniques

  • Activity loss:

    • Problem: Loss of enzymatic activity during purification or storage

    • Solution: Include stabilizing agents (50% glycerol as recommended for storage ), ensure presence of zinc or other essential cofactors, and minimize freeze-thaw cycles

  • Protein degradation:

    • Problem: Self-proteolysis or degradation by host proteases

    • Solution: Use protease-deficient expression hosts (like B. subtilis WB800N ), include protease inhibitors during purification, and optimize buffer conditions

Combining these approaches and carefully monitoring protein quality throughout the expression and purification process significantly improves the likelihood of obtaining active recombinant HtpX.

How can researchers verify the correctness of recombinant HtpX structure and function?

Verification of recombinant P. mendocina HtpX structure and function requires multiple complementary approaches:

  • Structural verification:

    • SDS-PAGE analysis to confirm expected molecular weight

    • Mass spectrometry for accurate mass determination and sequence coverage

    • Circular dichroism spectroscopy to assess secondary structure content

    • Limited proteolysis to probe protein folding and domain organization

  • Functional validation:

    • Enzyme activity assays using model substrates

    • Comparison of kinetic parameters with native enzyme (if available)

    • Metal dependency tests using chelators and metal supplementation

    • pH and temperature optima determination

  • Biophysical characterization:

    • Size exclusion chromatography to assess oligomeric state

    • Thermal shift assays to determine protein stability

    • Intrinsic fluorescence to monitor tertiary structure

  • Immunological confirmation:

    • Western blotting using antibodies against HtpX or affinity tags

    • Immunoprecipitation to confirm binding to known interaction partners

These validation methods provide comprehensive evidence for proper folding and function of recombinant HtpX, ensuring reliable results in subsequent research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.