Recombinant Pseudomonas mendocina UPF0060 membrane protein Pmen_1247 (Pmen_1247) is a protein expressed in E. coli and tagged with N-terminal His for identification and purification . It is derived from the bacterium Pseudomonas mendocina, specifically the UPF0060 membrane protein Pmen_1247 .
| Feature | Description |
|---|---|
| Cat.No. | RFL23502PF |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-110 amino acids) |
| Form | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE |
| AA Sequence | MTSYLWFLLAAVFEIAGCYAFWMWLRLDRSAWWIAPGLLSLVLFALILTRVEASFAGRAYAAYGGVYIVASLAWLALIEKTRPMLSDWLGAALCLAGAAIILFAPRLHTS |
| Gene Name | Pmen_1247 |
| Synonyms | Pmen_1247; UPF0060 membrane protein Pmen_1247 |
| UniProt ID | A4XRP6 |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Storage Condition | Store at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles. |
Pseudomonas mendocina is a bacterium commonly isolated from soil and water samples . It has the capability to synthesize medium-chain-length polyhydroxyalkanoate (PHA MCL) and alginate oligosaccharides (AO) simultaneously from glucose under conditions of limited nitrogen . The complete genome sequence of P. mendocina NK-01, consisting of 5.4 million base pairs, has been determined, revealing genes related to PHA MCL and AO synthesis .
The Pmen_1247 protein is encoded by the gene Pmen_1247 in Pseudomonas mendocina . It is also known as UPF0060 membrane protein Pmen_1247 . The protein has a UniProt ID of A4XRP6 .
Recombinant Pmen_1247 protein is utilized in various research applications. For example, it can be used as an antigen in ELISA assays . It also plays roles in different pathways, interacting with proteins and molecules, which are detected through methods such as yeast two-hybrid assays, co-IP, and pull-down assays .
P. mendocina possesses endogenous strong promoters that can be screened and utilized for enhanced transcription of specific genes . For instance, five strong promoters (P4, P6, P9, P16, and P25) have been identified based on transcriptional level and GFP fluorescence intensity measurements . These promoters can be integrated upstream of genes like phaC to enhance their transcription, which is relevant in metabolic pathway engineering .
KEGG: pmy:Pmen_1247
STRING: 399739.Pmen_1247
Recombinant Pmen_1247 should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. For short-term storage, working aliquots can be stored at 4°C for up to one week. The protein is typically supplied in either liquid form or as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For lyophilized protein, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol (final concentration) for long-term storage .
Recombinant Pmen_1247 is primarily expressed in E. coli expression systems. The full-length protein (amino acids 1-110) is typically fused to an N-terminal His-tag or other affinity tags to facilitate purification . The expression in prokaryotic systems like E. coli is advantageous for membrane proteins due to the simplicity of culture conditions and higher protein yields, though careful optimization may be required to ensure proper folding of membrane proteins.
When designing experiments to study the function of Pmen_1247, follow these systematic steps:
Define your variables clearly: Identify independent variables (e.g., expression conditions, mutations in Pmen_1247) and dependent variables (e.g., membrane localization, protein-protein interactions) .
Formulate specific, testable hypotheses: For example, "Mutation of the conserved residues in the transmembrane domains of Pmen_1247 will disrupt its membrane localization."
Include appropriate controls: Use both positive controls (wild-type Pmen_1247) and negative controls (empty vector, unrelated membrane protein) to validate experimental outcomes .
Consider experimental treatments: Design treatments that specifically manipulate your independent variables while controlling for extraneous factors.
Establish measurement protocols: Determine how you will quantitatively or qualitatively assess your dependent variables, ensuring reproducibility and precision .
Additionally, consider potential confounding variables, such as expression levels, post-translational modifications, or interactions with endogenous proteins in your expression system .
When investigating the membrane localization of Pmen_1247, include the following controls:
Positive controls:
Well-characterized membrane proteins with known localization patterns
Wild-type Pmen_1247 with confirmed localization
Negative controls:
Cytoplasmic proteins that do not localize to membranes
Truncated versions of Pmen_1247 lacking transmembrane domains
Experimental validation controls:
Multiple detection methods (e.g., fluorescent tagging, subcellular fractionation)
Different cell types or expression systems to confirm consistent localization patterns
Technical controls:
Markers for different cellular compartments
Membrane fraction purity controls
This multi-faceted control strategy helps distinguish authentic membrane localization from experimental artifacts and provides robust validation of your findings .
To investigate protein-protein interactions of Pmen_1247, consider these methodological approaches:
Co-immunoprecipitation (Co-IP):
Express His-tagged Pmen_1247 in an appropriate system
Solubilize membranes with mild detergents that preserve protein-protein interactions
Perform pull-down assays using anti-His antibodies
Identify binding partners through mass spectrometry
Yeast Two-Hybrid (Y2H) with membrane adaptations:
Use split-ubiquitin or MYTH (Membrane Yeast Two-Hybrid) systems specifically designed for membrane proteins
Create bait constructs with Pmen_1247 fused to the C-terminal domain of ubiquitin
Screen against prey libraries fused to the N-terminal domain of ubiquitin
Proximity-based labeling:
Generate Pmen_1247 fusions with BioID or APEX2
Express in cells and activate the enzyme to biotinylate proximal proteins
Purify biotinylated proteins and identify by mass spectrometry
Crosslinking Mass Spectrometry:
Use membrane-permeable crosslinkers to stabilize transient interactions
Digest complexes and identify crosslinked peptides by MS/MS
When analyzing results, be mindful of potential false positives due to hydrophobic interactions common with membrane proteins. Validate key interactions using orthogonal methods and consider the biological context of identified interactions .
To study Pmen_1247 function across Pseudomonas species, implement a comparative functional genomics approach:
Comparative sequence analysis:
Identify orthologs of Pmen_1247 across Pseudomonas species using bioinformatics tools
Analyze sequence conservation, particularly in functional domains
Generate phylogenetic trees to understand evolutionary relationships
Complementation studies:
Create knockout mutants of Pmen_1247 orthologs in different Pseudomonas species
Complement with Pmen_1247 from P. mendocina
Assess restoration of phenotypes to determine functional conservation
Domain swapping experiments:
Design chimeric proteins with domains from Pmen_1247 orthologs
Express in appropriate model systems
Evaluate which domains contribute to species-specific functions
Heterologous expression:
Express Pmen_1247 orthologs from different species in a common host
Compare localization, interaction partners, and functional outputs
Comparative transcriptomics:
Analyze expression patterns of Pmen_1247 orthologs under various conditions
Identify co-expressed genes that might form functional networks
This multi-faceted approach allows for robust cross-species comparisons while controlling for species-specific variables that might influence protein function .
Membrane proteins like Pmen_1247 present significant solubility challenges. Address these with the following strategies:
Optimized extraction conditions:
Test a panel of detergents (e.g., DDM, CHAPS, OG) at different concentrations
Evaluate various buffer compositions (pH, salt concentration, presence of glycerol)
Include stabilizing agents such as specific lipids or cholesterol
Protein engineering approaches:
Create fusion constructs with solubility-enhancing partners (e.g., MBP, SUMO, thioredoxin)
Consider truncation constructs that preserve key domains while removing highly hydrophobic regions
Introduce targeted mutations that enhance solubility without affecting function
Alternative expression systems:
Try eukaryotic expression systems for complex membrane proteins
Consider cell-free expression systems with added lipid nanodiscs or detergent micelles
Nanodiscs or proteoliposome reconstitution:
Extract the protein with detergent, then reconstitute into nanodiscs or proteoliposomes
This approach maintains a lipid environment while providing sample homogeneity
For Pmen_1247 specifically, initial purification in a Tris/PBS-based buffer with 6% Trehalose (pH 8.0) has proven effective . Document all optimization steps systematically to develop a reproducible protocol for your specific experimental needs.
When confronted with contradictory findings regarding membrane proteins like Pmen_1247, implement this structured approach:
Systematic context analysis:
Categorize contradictions based on contextual characteristics:
a) Internal to the experimental system (species, cell type, genetic background)
b) External factors (expression conditions, purification methods)
c) Endogenous vs. exogenous expression
d) Known controversies in the field
e) Methodological differences
Critical evaluation of methodological differences:
Consider temporal and conditional factors:
Validation experiments:
Design experiments that directly address the contradictions
Include side-by-side comparisons of methodologies that yielded contradictory results
Implement multiple orthogonal techniques to validate findings
In a systematic review of biomedical literature contradictions, researchers found that only 2.6% of initially identified contradictory pairs represented genuine contradictions after context analysis. Most apparent contradictions could be resolved through careful examination of experimental context .
For analyzing membrane protein localization experiments with Pmen_1247, employ these statistical approaches:
Quantitative image analysis:
For fluorescence microscopy: Measure colocalization with membrane markers using Pearson's correlation coefficient or Manders' overlap coefficient
Analyze signal intensity profiles across cell sections
Apply appropriate thresholding methods to distinguish specific from background signals
Subcellular fractionation quantification:
Use Western blot band densitometry to quantify protein distribution across fractions
Calculate enrichment factors relative to marker proteins for each compartment
Implement normalization strategies to account for fraction loading variations
Statistical testing:
For comparing multiple conditions: ANOVA with appropriate post-hoc tests
For paired comparisons: t-tests with correction for multiple comparisons
Consider non-parametric alternatives if data doesn't meet normality assumptions
Reproducibility assessment:
Calculate intra-class correlation coefficients for technical replicates
Report effect sizes alongside p-values
Implement bootstrapping approaches for robust confidence interval estimation
When presenting results, include both representative images and quantitative analyses. Report all statistical parameters including sample sizes, measures of center, dispersion measurements, and precise p-values .
To resolve contradictory findings about Pmen_1247 function, develop rigorous experimental protocols following these principles:
Comprehensive experimental design:
Multi-method validation:
Apply at least three independent methodological approaches
Compare in vitro, cellular, and in silico approaches when possible
Document the limitations and strengths of each method
Controlled variable exploration:
Systematically test conditions implicated in contradictory findings
Create a matrix of experimental conditions spanning the disparate results
Control for batch effects and environmental variables
Transparent reporting:
Document all experimental parameters in detail
Report negative and inconclusive results alongside positive findings
Provide raw data and analysis scripts for reproducibility
Sequential refinement approach:
Begin with replication of contradictory findings using original methods
Systematically modify variables one at a time
Identify the specific conditions that produce each outcome
Develop a unified model that explains context-dependent functions
Research on contradictions in biomedical literature has identified five main categories of context differences that explain apparent contradictions. By systematically addressing these categories in your experimental design, you can resolve seeming contradictions and develop a more nuanced understanding of Pmen_1247 function .