Recombinant Pseudomonas mendocina UPF0060 membrane protein Pmen_1247 (Pmen_1247)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Pseudomonas mendocina UPF0060 membrane protein Pmen_1247 (Pmen_1247) is a protein expressed in E. coli and tagged with N-terminal His for identification and purification . It is derived from the bacterium Pseudomonas mendocina, specifically the UPF0060 membrane protein Pmen_1247 .

Table 1: Key Features of Recombinant Pmen_1247 Protein

FeatureDescription
Cat.No.RFL23502PF
SourceE. coli
TagHis
Protein LengthFull Length (1-110 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
AA SequenceMTSYLWFLLAAVFEIAGCYAFWMWLRLDRSAWWIAPGLLSLVLFALILTRVEASFAGRAYAAYGGVYIVASLAWLALIEKTRPMLSDWLGAALCLAGAAIILFAPRLHTS
Gene NamePmen_1247
SynonymsPmen_1247; UPF0060 membrane protein Pmen_1247
UniProt IDA4XRP6
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage ConditionStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles.

Biological Context of Pseudomonas mendocina

Pseudomonas mendocina is a bacterium commonly isolated from soil and water samples . It has the capability to synthesize medium-chain-length polyhydroxyalkanoate (PHA MCL) and alginate oligosaccharides (AO) simultaneously from glucose under conditions of limited nitrogen . The complete genome sequence of P. mendocina NK-01, consisting of 5.4 million base pairs, has been determined, revealing genes related to PHA MCL and AO synthesis .

Gene and Protein Information

The Pmen_1247 protein is encoded by the gene Pmen_1247 in Pseudomonas mendocina . It is also known as UPF0060 membrane protein Pmen_1247 . The protein has a UniProt ID of A4XRP6 .

Applications in Research

Recombinant Pmen_1247 protein is utilized in various research applications. For example, it can be used as an antigen in ELISA assays . It also plays roles in different pathways, interacting with proteins and molecules, which are detected through methods such as yeast two-hybrid assays, co-IP, and pull-down assays .

Promoters in P. mendocina

P. mendocina possesses endogenous strong promoters that can be screened and utilized for enhanced transcription of specific genes . For instance, five strong promoters (P4, P6, P9, P16, and P25) have been identified based on transcriptional level and GFP fluorescence intensity measurements . These promoters can be integrated upstream of genes like phaC to enhance their transcription, which is relevant in metabolic pathway engineering .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pmen_1247; UPF0060 membrane protein Pmen_1247
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Pseudomonas mendocina (strain ymp)
Target Names
Pmen_1247
Target Protein Sequence
MTSYLWFLLAAVFEIAGCYAFWMWLRLDRSAWWIAPGLLSLVLFALILTRVEASFAGRAY AAYGGVYIVASLAWLALIEKTRPMLSDWLGAALCLAGAAIILFAPRLHTS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant Pmen_1247?

Recombinant Pmen_1247 should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles. For short-term storage, working aliquots can be stored at 4°C for up to one week. The protein is typically supplied in either liquid form or as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For lyophilized protein, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol (final concentration) for long-term storage .

What expression systems are used for Pmen_1247 production?

Recombinant Pmen_1247 is primarily expressed in E. coli expression systems. The full-length protein (amino acids 1-110) is typically fused to an N-terminal His-tag or other affinity tags to facilitate purification . The expression in prokaryotic systems like E. coli is advantageous for membrane proteins due to the simplicity of culture conditions and higher protein yields, though careful optimization may be required to ensure proper folding of membrane proteins.

How should I design experiments to study Pmen_1247 function?

When designing experiments to study the function of Pmen_1247, follow these systematic steps:

  • Define your variables clearly: Identify independent variables (e.g., expression conditions, mutations in Pmen_1247) and dependent variables (e.g., membrane localization, protein-protein interactions) .

  • Formulate specific, testable hypotheses: For example, "Mutation of the conserved residues in the transmembrane domains of Pmen_1247 will disrupt its membrane localization."

  • Include appropriate controls: Use both positive controls (wild-type Pmen_1247) and negative controls (empty vector, unrelated membrane protein) to validate experimental outcomes .

  • Consider experimental treatments: Design treatments that specifically manipulate your independent variables while controlling for extraneous factors.

  • Establish measurement protocols: Determine how you will quantitatively or qualitatively assess your dependent variables, ensuring reproducibility and precision .

Additionally, consider potential confounding variables, such as expression levels, post-translational modifications, or interactions with endogenous proteins in your expression system .

What controls should be included when studying membrane localization of Pmen_1247?

When investigating the membrane localization of Pmen_1247, include the following controls:

  • Positive controls:

    • Well-characterized membrane proteins with known localization patterns

    • Wild-type Pmen_1247 with confirmed localization

  • Negative controls:

    • Cytoplasmic proteins that do not localize to membranes

    • Truncated versions of Pmen_1247 lacking transmembrane domains

  • Experimental validation controls:

    • Multiple detection methods (e.g., fluorescent tagging, subcellular fractionation)

    • Different cell types or expression systems to confirm consistent localization patterns

  • Technical controls:

    • Markers for different cellular compartments

    • Membrane fraction purity controls

This multi-faceted control strategy helps distinguish authentic membrane localization from experimental artifacts and provides robust validation of your findings .

How can I investigate the protein-protein interactions of Pmen_1247?

To investigate protein-protein interactions of Pmen_1247, consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express His-tagged Pmen_1247 in an appropriate system

    • Solubilize membranes with mild detergents that preserve protein-protein interactions

    • Perform pull-down assays using anti-His antibodies

    • Identify binding partners through mass spectrometry

  • Yeast Two-Hybrid (Y2H) with membrane adaptations:

    • Use split-ubiquitin or MYTH (Membrane Yeast Two-Hybrid) systems specifically designed for membrane proteins

    • Create bait constructs with Pmen_1247 fused to the C-terminal domain of ubiquitin

    • Screen against prey libraries fused to the N-terminal domain of ubiquitin

  • Proximity-based labeling:

    • Generate Pmen_1247 fusions with BioID or APEX2

    • Express in cells and activate the enzyme to biotinylate proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Crosslinking Mass Spectrometry:

    • Use membrane-permeable crosslinkers to stabilize transient interactions

    • Digest complexes and identify crosslinked peptides by MS/MS

When analyzing results, be mindful of potential false positives due to hydrophobic interactions common with membrane proteins. Validate key interactions using orthogonal methods and consider the biological context of identified interactions .

What approaches can be used to study the function of Pmen_1247 across different Pseudomonas species?

To study Pmen_1247 function across Pseudomonas species, implement a comparative functional genomics approach:

  • Comparative sequence analysis:

    • Identify orthologs of Pmen_1247 across Pseudomonas species using bioinformatics tools

    • Analyze sequence conservation, particularly in functional domains

    • Generate phylogenetic trees to understand evolutionary relationships

  • Complementation studies:

    • Create knockout mutants of Pmen_1247 orthologs in different Pseudomonas species

    • Complement with Pmen_1247 from P. mendocina

    • Assess restoration of phenotypes to determine functional conservation

  • Domain swapping experiments:

    • Design chimeric proteins with domains from Pmen_1247 orthologs

    • Express in appropriate model systems

    • Evaluate which domains contribute to species-specific functions

  • Heterologous expression:

    • Express Pmen_1247 orthologs from different species in a common host

    • Compare localization, interaction partners, and functional outputs

  • Comparative transcriptomics:

    • Analyze expression patterns of Pmen_1247 orthologs under various conditions

    • Identify co-expressed genes that might form functional networks

This multi-faceted approach allows for robust cross-species comparisons while controlling for species-specific variables that might influence protein function .

How can I address solubility challenges when working with recombinant Pmen_1247?

Membrane proteins like Pmen_1247 present significant solubility challenges. Address these with the following strategies:

  • Optimized extraction conditions:

    • Test a panel of detergents (e.g., DDM, CHAPS, OG) at different concentrations

    • Evaluate various buffer compositions (pH, salt concentration, presence of glycerol)

    • Include stabilizing agents such as specific lipids or cholesterol

  • Protein engineering approaches:

    • Create fusion constructs with solubility-enhancing partners (e.g., MBP, SUMO, thioredoxin)

    • Consider truncation constructs that preserve key domains while removing highly hydrophobic regions

    • Introduce targeted mutations that enhance solubility without affecting function

  • Alternative expression systems:

    • Try eukaryotic expression systems for complex membrane proteins

    • Consider cell-free expression systems with added lipid nanodiscs or detergent micelles

  • Nanodiscs or proteoliposome reconstitution:

    • Extract the protein with detergent, then reconstitute into nanodiscs or proteoliposomes

    • This approach maintains a lipid environment while providing sample homogeneity

For Pmen_1247 specifically, initial purification in a Tris/PBS-based buffer with 6% Trehalose (pH 8.0) has proven effective . Document all optimization steps systematically to develop a reproducible protocol for your specific experimental needs.

How should I approach contradictory findings in the literature regarding membrane proteins similar to Pmen_1247?

When confronted with contradictory findings regarding membrane proteins like Pmen_1247, implement this structured approach:

  • Systematic context analysis:

    • Categorize contradictions based on contextual characteristics:
      a) Internal to the experimental system (species, cell type, genetic background)
      b) External factors (expression conditions, purification methods)
      c) Endogenous vs. exogenous expression
      d) Known controversies in the field
      e) Methodological differences

  • Critical evaluation of methodological differences:

    • Compare experimental designs, including controls, sample sizes, and statistical analyses

    • Assess whether contradictions arise from different methodological approaches

  • Consider temporal and conditional factors:

    • Examine whether contradictory findings occur under different conditions or time points

    • Evaluate whether apparent contradictions might represent context-dependent protein behavior

  • Validation experiments:

    • Design experiments that directly address the contradictions

    • Include side-by-side comparisons of methodologies that yielded contradictory results

    • Implement multiple orthogonal techniques to validate findings

In a systematic review of biomedical literature contradictions, researchers found that only 2.6% of initially identified contradictory pairs represented genuine contradictions after context analysis. Most apparent contradictions could be resolved through careful examination of experimental context .

What statistical approaches are recommended for analyzing membrane protein localization experiments involving Pmen_1247?

For analyzing membrane protein localization experiments with Pmen_1247, employ these statistical approaches:

  • Quantitative image analysis:

    • For fluorescence microscopy: Measure colocalization with membrane markers using Pearson's correlation coefficient or Manders' overlap coefficient

    • Analyze signal intensity profiles across cell sections

    • Apply appropriate thresholding methods to distinguish specific from background signals

  • Subcellular fractionation quantification:

    • Use Western blot band densitometry to quantify protein distribution across fractions

    • Calculate enrichment factors relative to marker proteins for each compartment

    • Implement normalization strategies to account for fraction loading variations

  • Statistical testing:

    • For comparing multiple conditions: ANOVA with appropriate post-hoc tests

    • For paired comparisons: t-tests with correction for multiple comparisons

    • Consider non-parametric alternatives if data doesn't meet normality assumptions

  • Reproducibility assessment:

    • Calculate intra-class correlation coefficients for technical replicates

    • Report effect sizes alongside p-values

    • Implement bootstrapping approaches for robust confidence interval estimation

When presenting results, include both representative images and quantitative analyses. Report all statistical parameters including sample sizes, measures of center, dispersion measurements, and precise p-values .

How can I develop rigorous experimental protocols to resolve contradictory findings about Pmen_1247 function?

To resolve contradictory findings about Pmen_1247 function, develop rigorous experimental protocols following these principles:

  • Comprehensive experimental design:

    • Implement factorial designs that systematically test multiple variables

    • Include time-series experiments to capture temporal dynamics

    • Use multiple time-points to avoid misleading snapshot data

  • Multi-method validation:

    • Apply at least three independent methodological approaches

    • Compare in vitro, cellular, and in silico approaches when possible

    • Document the limitations and strengths of each method

  • Controlled variable exploration:

    • Systematically test conditions implicated in contradictory findings

    • Create a matrix of experimental conditions spanning the disparate results

    • Control for batch effects and environmental variables

  • Transparent reporting:

    • Document all experimental parameters in detail

    • Report negative and inconclusive results alongside positive findings

    • Provide raw data and analysis scripts for reproducibility

  • Sequential refinement approach:

    • Begin with replication of contradictory findings using original methods

    • Systematically modify variables one at a time

    • Identify the specific conditions that produce each outcome

    • Develop a unified model that explains context-dependent functions

Research on contradictions in biomedical literature has identified five main categories of context differences that explain apparent contradictions. By systematically addressing these categories in your experimental design, you can resolve seeming contradictions and develop a more nuanced understanding of Pmen_1247 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.