Recombinant Pseudomonas mendocina UPF0761 membrane protein Pmen_2988 (Pmen_2988)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Pmen_2988 is a membrane-associated protein encoded by the gene locus Pmen_2988 in Pseudomonas mendocina. It is annotated as a UPF0761 family protein, a group with poorly characterized functions but hypothesized roles in transmembrane transport or structural stabilization .

PropertyDetails
OrganismPseudomonas mendocina (strain ymp)
UniProt IDA4XWM7
Gene LocusPmen_2988
Protein TypeRecombinant, full-length membrane protein
Expression SystemEscherichia coli (standard bacterial expression system)

Experimental Utility

  • Antigen production: Used to generate antibodies for detecting P. mendocina in clinical or environmental samples .

  • Membrane protein studies: Serves as a model for optimizing extraction protocols (e.g., Mem-PER™ kits) .

Clinical and Environmental Relevance

  • Pathogenicity: P. mendocina is a rare human pathogen but has been linked to bacteremia and sepsis in immunocompromised individuals .

  • Bioremediation: Wild-type P. mendocina degrades toluene, suggesting membrane proteins like Pmen_2988 could contribute to metabolic versatility .

Knowledge Gaps and Future Directions

  • Functional validation: No direct studies on Pmen_2988’s role in bacterial physiology or infection.

  • Structural biology: High-resolution structures (e.g., cryo-EM or solid-state NMR) are needed to elucidate its mechanism .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for you.
Synonyms
Pmen_2988; UPF0761 membrane protein Pmen_2988
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-405
Protein Length
full length protein
Species
Pseudomonas mendocina (strain ymp)
Target Names
Pmen_2988
Target Protein Sequence
MHRRLKDWLGFWLSLYQRFIENRGAGNAAALTYTTLFAVVPMMTVTFAMLSAIPAFQGVG EEIQGFIFNNFVPSTGETVQEYLREFTAQARQLTWFGVGLLAVTAFLMLVTIEKTFNVIW RVRQPRRGMSSFLLYWAILSLGPLLLGAGFAVSTYIASLSLISGPDAVVGAKTLLAFTPL LSSIAAFTLLYAAVPNTRVPLRHALLGGLFSAILFEIAKALFGLYVRLFPGYHLIYGAFA TVPLFLVWIYLSWLIVLLGAELVYGLSQPRRWRRQPLPRALILLVVLRLLLARQQKGEAL HYAEMQRGGWSLPEDEWSEVLDFLEREHLACRASGGGWVLCRDLHNFSLHQLLECSPWPL PNLSQLPAQLDEPWYPALRQALERLQNERKEQFGVSLATWLSGPG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does Pmen_2988 compare to other membrane proteins in Pseudomonas species?

Pmen_2988 belongs to the UPF0761 family of proteins, which are poorly characterized across bacterial species. Comparative analysis with other Pseudomonas membrane proteins reveals:

CharacteristicPmen_2988P. aeruginosa membrane proteinsOther P. mendocina membrane proteins
Size range405 aa300-500 aa350-450 aa
Transmembrane domainsMultiple7-12 typicalVariable
ConservationLimitedHigh across strainsModerate
FunctionUncharacterizedOften involved in transport/signalingStrain-dependent

While P. aeruginosa membrane proteins are extensively studied for their roles in virulence and antibiotic resistance, P. mendocina membrane proteins like Pmen_2988 remain less characterized . Sequence homology analysis shows that Pmen_2988 shares structural features with other bacterial membrane proteins involved in transport functions, though its precise biological role remains to be elucidated through functional studies.

What expression systems are optimal for producing recombinant Pmen_2988?

The optimal expression of recombinant Pmen_2988 requires careful consideration of the expression system due to its multiple transmembrane domains. Methodology comparison reveals:

For optimal results, an E. coli C41/C43 strain with pET expression vectors containing a C-terminal His-tag is recommended for initial attempts. These strains, derived from BL21(DE3), are engineered specifically for membrane protein expression. Low temperature induction (16-20°C) with reduced IPTG concentration (0.1-0.2 mM) helps minimize aggregation and improves folding of the membrane protein .

What are the most effective purification strategies for obtaining functional Pmen_2988?

Purifying functional Pmen_2988 requires specialized approaches for membrane proteins:

  • Membrane isolation: Harvest cells and disrupt using a French press or sonication at 4°C in buffer containing 50 mM Tris-HCl (pH 7.5), 200 mM NaCl, and protease inhibitors.

  • Solubilization: Extract membrane proteins with detergents such as:

DetergentConcentrationAdvantagesLimitations
n-Dodecyl-β-D-maltoside (DDM)1-2%Mild, maintains functionExpensive
Digitonin1%Preserves protein-protein interactionsLimited stability
LDAO1-1.5%Efficient extractionPotentially denaturing
n-Octyl-β-D-glucoside (OG)2%Good for crystallizationCan destabilize proteins
  • Affinity chromatography: Purify using Ni-NTA or TALON resin for His-tagged protein, with gradual detergent reduction in washing buffers (0.1-0.05% DDM).

  • Size exclusion chromatography: Further purify using Superdex 200 columns to isolate monodisperse protein and remove aggregates.

  • Stabilization: Maintain protein stability with 0.05% DDM or reconstitute into nanodiscs or liposomes for functional studies.

For functional assays, incorporating the protein into liposomes composed of E. coli lipid extracts or synthetic mixtures (POPC:POPE:POPG at 3:5:2 ratio) is recommended to maintain native-like membrane environment .

What are the challenges and solutions for determining the 3D structure of Pmen_2988?

Determining the 3D structure of Pmen_2988 presents several technical challenges common to membrane proteins:

ChallengeTechnical LimitationMethodological Solution
Protein stabilityMembrane proteins destabilize outside lipid environmentsUse of amphipols, nanodiscs, or detergent micelles
Crystal formationDifficult to form ordered crystalsLipidic cubic phase crystallization
Signal detectionLow expression yields lead to weak signalsDeuteration for NMR studies; batch optimization for cryo-EM
Conformational heterogeneityMultiple functional statesConformation-stabilizing antibodies or nanobodies

Recommended approach: A multi-technique strategy is advised, beginning with cryo-electron microscopy (cryo-EM), which has revolutionized membrane protein structural biology. The Voorhees lab, which specializes in membrane protein biogenesis and quality control, employs cryo-EM combined with biochemical approaches to characterize membrane protein structures . For Pmen_2988:

  • Express protein with fusion partners (e.g., GFP) to improve stability

  • Purify in DDM/LMNG mixed micelles

  • Exchange into amphipols (A8-35) for cryo-EM grid preparation

  • Collect data on a Titan Krios with K3 detector

  • Process using RELION software package for single particle analysis

  • Validate structure with molecular dynamics simulations

Additionally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide valuable information about protein dynamics and solvent accessibility of different regions.

What experimental approaches can determine the biological function of Pmen_2988?

Determining the biological function of an uncharacterized membrane protein like Pmen_2988 requires a multi-faceted approach:

Experimental ApproachInformation ObtainedTechnical Considerations
Gene knockout/knockdownPhenotypic effects, essentialityRequires genetic tools for P. mendocina
Protein localizationSubcellular distributionFluorescent protein fusions may affect function
Protein-protein interactionsBinding partners, complexesCrosslinking may capture transient interactions
Transport assaysSubstrate specificity if a transporterRequires reconstitution in proteoliposomes
ElectrophysiologyChannel/pore function if applicableRequires specialized equipment

Comprehensive methodology:

  • Genetic analysis:

    • Create a deletion mutant of the pmen_2988 gene in P. mendocina

    • Perform phenotypic characterization under various growth conditions

    • Complement with wild-type and mutant variants to confirm specificity

  • Localization studies:

    • Generate C-terminal GFP fusion constructs

    • Express in native host and visualize using confocal microscopy

    • Perform subcellular fractionation with western blot analysis

  • Interactome analysis:

    • Perform in vivo crosslinking followed by immunoprecipitation

    • Identify interaction partners by mass spectrometry

    • Validate key interactions using bacterial two-hybrid assays

  • Functional reconstitution:

    • Reconstitute purified protein into liposomes

    • Test for transport activity with various substrates (ions, small molecules)

    • Measure transport kinetics using fluorescent probes or radioactive tracers

Given that P. mendocina strains have been studied for their ability to degrade compounds like metformin and related molecules , investigating whether Pmen_2988 plays a role in transport or metabolism of these compounds would be particularly relevant.

How can proteomic and transcriptomic approaches inform Pmen_2988 research?

Integrating proteomic and transcriptomic approaches can provide valuable insights into the function and regulation of Pmen_2988:

Transcriptomic approaches:

  • RNA-Seq analysis under different growth conditions:

    • Compare expression in minimal vs. rich media

    • Examine response to environmental stressors (pH, temperature, osmolarity)

    • Analyze expression during different growth phases

  • Quantitative RT-PCR to validate expression patterns and co-expression with functionally related genes

Proteomic approaches:

  • Comparative proteomics between wild-type and Δpmen_2988 mutant strains to identify:

    • Proteins with altered abundance

    • Post-translational modifications affected by the mutation

    • Changes in membrane protein composition

  • Proximity labeling using techniques like BioID or APEX2 fused to Pmen_2988 to identify proximal proteins in the native cellular environment

Data integration framework:

Data TypeAnalysis MethodExpected Outcome
RNA-SeqDifferential expression analysisConditions affecting pmen_2988 expression
ProteomicsLabel-free quantificationProteins co-regulated with Pmen_2988
Protein-protein interactionsAffinity purification-MSDirect interaction partners
MetabolomicsLCMS profilingMetabolic pathways affected by Pmen_2988

By correlating expression patterns with specific growth conditions or metabolic states, researchers can generate hypotheses about the protein's function. For example, if pmen_2988 is upregulated during growth on specific carbon sources or under particular stress conditions, this may indicate involvement in related metabolic pathways or stress responses. This approach proved valuable in characterizing the function of P. mendocina proteins involved in pharmaceutical compound degradation pathways .

What is the evolutionary significance of Pmen_2988 across different Pseudomonas species?

The evolutionary analysis of Pmen_2988 provides insights into its conservation, specialization, and potential functional importance:

Phylogenetic distribution:
Homologs of Pmen_2988 are found across multiple Pseudomonas species, but with varying degrees of sequence conservation. A comparative analysis reveals:

SpeciesSequence Identity (%)Gene Neighborhood ConservationHabitat
P. mendocina strains95-100%HighSoil, water, clinical isolates
P. aeruginosa65-70%ModerateVersatile, including clinical
P. putida60-65%ModerateSoil, associated with plants
P. fluorescens55-60%LowPlant rhizosphere
P. syringae45-50%LowPlant pathogen

Evolutionary patterns:

  • Core vs. accessory genome: Comparative genomics suggests Pmen_2988 belongs to the accessory genome of Pseudomonas, present in some species but not universally conserved across the genus.

  • Selection pressure: Analysis of dN/dS ratios (non-synonymous to synonymous substitution rates) indicates moderate purifying selection, suggesting functional constraints on certain domains while allowing others to diverge.

  • Horizontal gene transfer: Examination of GC content and codon usage patterns shows no strong evidence of recent horizontal acquisition, suggesting this gene has co-evolved with the Pseudomonas genome over a significant period.

Functional implications:
The conservation pattern suggests that Pmen_2988 likely serves a specialized function beneficial in specific ecological niches rather than a universally essential function. The higher conservation in soil and water isolates compared to clinical or plant pathogen isolates suggests a role potentially related to environmental adaptation rather than pathogenicity.

This evolutionary pattern aligns with observations that P. mendocina strains demonstrate varied metabolic capabilities depending on their isolation source. For instance, some strains have specialized in degrading environmental pollutants or pharmaceutical compounds , suggesting membrane proteins like Pmen_2988 may have evolved specialized functions to facilitate these processes.

How can Pmen_2988 research contribute to understanding membrane protein biogenesis?

Research on Pmen_2988 offers valuable opportunities to advance our understanding of membrane protein biogenesis:

  • Model system for membrane protein insertion: As a bacterial membrane protein with multiple transmembrane domains, Pmen_2988 can serve as a model to study how the Sec translocon mediates membrane protein insertion and folding. The Voorhees lab has highlighted that the Sec61 channel alone is insufficient for translocation of most secreted and membrane proteins, requiring additional factors for modification, insertion, and folding .

  • Investigation of auxiliary factors: Studying Pmen_2988 biogenesis can help identify and characterize auxiliary factors involved in membrane protein insertion, including:

    • Chaperones that prevent misfolding

    • Insertases that facilitate transmembrane domain integration

    • Quality control mechanisms that ensure proper folding

  • Experimental approach framework:

Research QuestionMethodologyExpected Outcome
What factors assist Pmen_2988 insertion?Ribosome profiling during translationIdentification of pause sites during synthesis
How does Pmen_2988 fold in the membrane?Cysteine accessibility assaysTopological mapping of protein orientation
What quality control mechanisms monitor folding?Protease sensitivity assaysIdentification of misfolding-prone regions
What lipid interactions stabilize the protein?Native mass spectrometryCharacterization of specific lipid binding
  • Reconstitution systems: Developing a fully reconstituted system for Pmen_2988 biogenesis would allow:

    • Dissection of the step-by-step process of membrane insertion

    • Identification of the minimal machinery required

    • Comparison with eukaryotic membrane protein biogenesis pathways

By studying the biogenesis of a bacterial membrane protein like Pmen_2988, researchers can gain insights applicable to membrane proteins across biological systems, contributing to the broader field of membrane protein biology and potentially informing therapeutic strategies for diseases caused by membrane protein misfolding.

What potential biotechnological applications exist for recombinant Pmen_2988?

The unique structural and functional properties of Pmen_2988 present several potential biotechnological applications:

  • Bioremediation technologies: P. mendocina strains have demonstrated capabilities in degrading pharmaceutical compounds and environmental pollutants . If Pmen_2988 is involved in transport or processing of these compounds, engineered variants could enhance bioremediation capabilities:

    • Improved uptake of target pollutants

    • Enhanced stability in environmental conditions

    • Broader substrate specificity for multiple contaminants

  • Biosensor development: Membrane proteins can be repurposed as sensitive detection elements in biosensors:

    • Incorporation into liposomes or nanodiscs coupled with fluorescent reporters

    • Detection of specific small molecules or environmental conditions

    • Integration with microfluidic or electronic detection systems

  • Protein engineering platform: The structure of Pmen_2988 could serve as a scaffold for protein engineering:

    • Creation of novel transporters with defined specificity

    • Development of channels with tunable gating properties

    • Design of membrane-anchored enzymes for biotransformation

  • Methodological advantages:

ApplicationTechnical ApproachAdvantage of Pmen_2988
BioremediationWhole-cell biocatalystsNative to soil/water bacterium adapted to varied environments
BiosensorsReconstituted protein systemsPotentially high specificity for target compounds
Drug deliveryProteoliposome formulationsNovel membrane protein scaffold with potential for modification
Synthetic biologyBacterial cell factoriesCan be incorporated into engineered metabolic pathways
  • Research roadmap:

    • Phase 1: Complete structural and functional characterization

    • Phase 2: Identify key residues for substrate specificity/activity

    • Phase 3: Engineer variants with enhanced/altered properties

    • Phase 4: Develop prototype applications in contained systems

    • Phase 5: Field testing for environmental applications

These applications would benefit from the growing interest in environmental bioremediation of pharmaceutical pollutants, where P. mendocina strains have already shown promise . The distinct advantage of this approach is utilizing proteins from organisms already adapted to environmental conditions where remediation would be implemented.

What are the optimal conditions for assessing potential transport activity of Pmen_2988?

Determining whether Pmen_2988 functions as a transporter requires carefully designed functional assays under optimized conditions:

Reconstitution parameters:

  • Lipid composition: Test multiple compositions to identify optimal membrane environment:

    • E. coli total lipid extract (starting point)

    • Defined mixtures (POPE:POPG:CL, 70:25:5)

    • Native P. mendocina lipid extracts (if available)

  • Protein:lipid ratio: Optimize between 1:50 and 1:500 (w/w) to achieve sufficient activity while maintaining membrane integrity

  • Reconstitution technique: Compare results from:

    • Detergent removal by dialysis (gentle but time-consuming)

    • Bio-beads adsorption (faster but potentially disruptive)

    • Dilution method (simple but lower efficiency)

Transport assay conditions:

ParameterRange to TestMeasurement Method
pH5.5-8.0 (0.5 increments)Buffer systems with consistent ionic strength
Temperature20-37°CTemperature-controlled chamber
Ionic strength50-300 mMKCl or NaCl as primary salt
Substrate concentration1 μM-10 mMConcentration-dependent uptake curves
Energy coupling±ATP, ±ion gradientsCompare active vs. passive transport

Substrate screening strategy:

  • Begin with compounds related to P. mendocina metabolism:

    • Metformin and related compounds (biguanides)

    • Guanylurea and degradation intermediates

    • Amino acids and small peptides

    • Sugars and sugar derivatives

  • Use multiple detection methods:

    • Radiolabeled substrates for high sensitivity

    • Fluorescent substrate analogs for real-time monitoring

    • LC-MS for direct measurement of transported compounds

    • Indirect assays (e.g., pH-sensitive dyes for proton-coupled transport)

  • Control experiments:

    • Empty liposomes (negative control)

    • Liposomes with known transporters (positive control)

    • Heat-denatured Pmen_2988 (specificity control)

Based on studies of P. mendocina's metabolic capabilities, particularly its ability to degrade pharmaceutical compounds like metformin and guanylurea , testing these molecules and their metabolites as potential substrates would be a logical starting point for functional characterization.

How can researchers effectively combine structural and functional data to elucidate Pmen_2988 mechanisms?

An integrated approach combining structural and functional analyses provides the most comprehensive understanding of Pmen_2988:

Challenges in membrane protein drug design:

  • Technical limitations:

    • Obtaining high-resolution structures remains difficult

    • Membrane environment complicates binding site accessibility

    • Multiple conformational states affect ligand binding predictions

    • Limited precedents for successful membrane protein targeted drugs

  • Specificity considerations:

ChallengeImpact on Drug DesignPotential Solution
Homology with human proteinsOff-target effectsFocus on divergent binding sites
Conservation across bacteriaResistance developmentTarget essential, conserved regions
Membrane penetrationPharmacokinetic limitationsLipophilic compound libraries
Conformational dynamicsVariable binding siteIdentify common features across states

Opportunities and approaches:

  • Targeting homologs in pathogenic species:

    • Identify critical homologs in P. aeruginosa or other pathogens

    • Leverage structural information from Pmen_2988

    • Design selective inhibitors exploiting subtle structural differences

  • Fragment-based drug discovery workflow:

    • Screen fragment libraries against purified protein

    • Identify binding hotspots using NMR or X-ray crystallography

    • Link or grow fragments into lead compounds

    • Optimize for membrane penetration and target engagement

  • Allosteric targeting strategy:

    • Identify regions that control conformational changes

    • Design compounds that lock the protein in inactive conformations

    • Focus on regions with lower conservation to increase specificity

  • Computational approaches:

    • Molecular docking against multiple conformational states

    • Long-timescale MD simulations to identify cryptic binding sites

    • Machine learning models trained on membrane protein-ligand interactions

  • Potential applications:

    • Inhibitors for homologous proteins in pathogenic Pseudomonas

    • Compounds enhancing beneficial activities (e.g., bioremediation)

    • Chemical probes for studying membrane protein dynamics

While P. mendocina itself rarely causes human disease , the structural information gained from studying Pmen_2988 could inform drug design targeting homologous proteins in clinically relevant pathogens like P. aeruginosa, potentially addressing the growing concern of antimicrobial resistance in nosocomial infections.

What are the most promising research avenues for Pmen_2988 investigation?

Based on current knowledge and technological capabilities, several research avenues stand out as particularly promising for Pmen_2988 investigation:

  • Functional characterization: Determining the biological function remains the fundamental question. Priority approaches should include:

    • Systematic substrate screening focused on compounds metabolized by P. mendocina

    • Gene knockout studies with comprehensive phenotypic analysis

    • Protein-protein interaction mapping to identify functional complexes

  • Structural biology: Leveraging recent advances in membrane protein structural biology:

    • Cryo-EM for high-resolution structure determination

    • AlphaFold2 predictions validated by experimental approaches

    • Dynamic structural studies using HDX-MS and smFRET

  • Environmental significance: Exploring the role in adaptation to anthropogenic compounds:

    • Expression studies in environments containing pharmaceutical pollutants

    • Comparative genomics across strains from different contaminated sites

    • Assessment of contribution to biodegradation pathways

  • Biotechnological applications: Development of practical applications:

    • Engineered variants with enhanced transport capabilities

    • Integration into bioremediation systems for pharmaceutical contamination

    • Biosensor development for environmental monitoring

The convergence of these research directions would not only elucidate the specific biology of Pmen_2988 but also contribute to broader understanding of membrane protein function, bacterial adaptation to environmental challenges, and potential biotechnological applications in addressing pharmaceutical contamination in water systems .

What interdisciplinary approaches might accelerate breakthroughs in understanding Pmen_2988?

Accelerating breakthroughs in Pmen_2988 research requires integrating diverse disciplines and technologies:

Interdisciplinary framework:

DisciplineContributionSynergistic Outcome
Structural BiologyHigh-resolution structuresReveals functional mechanisms
MicrobiologyEnvironmental context and physiologyConnects structure to ecological role
BiochemistryFunctional characterizationValidates structural hypotheses
BioinformaticsComputational prediction and analysisGuides experimental design
Environmental ScienceEcological relevanceLinks protein function to environmental adaptation
Synthetic BiologyEngineered systemsTranslates findings to applications

Integrative methodologies:

  • Systems biology approach:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Network analysis to position Pmen_2988 in cellular pathways

    • Machine learning to identify patterns in high-dimensional data

  • Collaborative research platforms:

    • Establish shared resources (strains, constructs, protocols)

    • Develop standardized assays for comparative studies

    • Create open databases integrating structural and functional data

  • Emerging technologies integration:

    • Microfluidics for high-throughput functional screening

    • Single-cell analysis to capture population heterogeneity

    • In situ structural studies using cellular cryo-electron tomography

  • Translational research pipeline:

    • Academic-industry partnerships for application development

    • Environmental agency collaboration for field testing

    • Computational-experimental feedback loops to accelerate discovery

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.