Recombinant Pseudomonas phage Pf1 Attachment protein G3P (III)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-437
Protein Length
Full Length of Mature Protein
Species
Pseudomonas phage Pf1 (Bacteriophage Pf1)
Target Names
III
Target Protein Sequence
GPYIWEVVMYSSSGSSTPAEACEKARVVADRSPDWNYTSATPKMNGLDNSYCSVVYVSRR DPSVVNTCDDCASWKLFRKGDQCANADDTYNASTGICEPPPKECKEGELFPAKGPDSPVV TSGGRNYVGDGGAPTACYQSCEYGGNPSPASCYLVKGSTTTGFCNYILKGTGQSCGADSY TFSQTGDSLNPPDTPNTDPSDPNDPGCPPGWSWSGTTCVKTPTDPTDPTDPTTPGGDGGG DGNGGGNNNGGGNDGGTGNGDGSGGGDGNGAGDGSGDGDGSGTGGDGNGTCDPAKENCST GPEGPGGELKEPTPGTWDDAIATWEKKVEEAKKELKTKVKANVDQMKGAFDLNLAEGGGQ LPCESMTIWGKSYSLCISDYAGQLSSLRVALLLMAALIAALILLKD
Uniprot No.

Target Background

Function

Recombinant Pseudomonas phage Pf1 Attachment protein G3P (III) plays crucial roles in both viral genome penetration into the bacterial host via pilus retraction and virion extrusion. Initially, G3P mediates phage adsorption to the host type IV PAK pilus tip. Subsequent interaction with the host entry receptor triggers viral DNA penetration into the host cytoplasm. During extrusion, G3P's C-terminal domain facilitates the release of the membrane-anchored virion from the cell.

Database Links

KEGG: vg:1260714

Protein Families
Inovirus G3P protein family
Subcellular Location
Virion. Host membrane; Single-pass type I membrane protein. Note=Prior to assembly, G3P is found associated with the bacterial host inner membrane. There are about five copies of this protein per mature phage that are located on the head side of the filamentous virion.

Q&A

What is the structure and function of Pseudomonas phage Pf1 Attachment protein G3P (III)?

G3P (Gene 3 Protein) is a minor coat protein found in filamentous bacteriophages including Pseudomonas phage Pf1. Structurally, the N-terminal domain (g3p-D1) consists of a six-stranded beta barrel that is topologically identical to a permutated SH3 domain, capped by an additional N-terminal alpha helix . The protein contains a widespread hydrogen-bond network within the beta barrel and N-terminal alpha helix, complemented by two disulfide bridges that render it highly stable in harsh extracellular environments .

Functionally, G3P mediates infection of bacteria bearing an F-pilus. The N-terminal domain (g3p-D1) is essential for infection, as it mediates penetration of the phage into the host cytoplasm through interaction with the Tol complex in bacterial membranes . This structural arrangement is conserved across various filamentous phages, suggesting a shared infection pathway .

How does recombinant G3P differ from native phage-produced G3P?

Recombinant G3P can be produced in multiple expression systems including yeast, E. coli, baculovirus, and mammalian cells . The recombinant versions may include various fusion tags depending on experimental requirements. Key differences include:

FeatureNative G3PRecombinant G3P
SourceBacteriophageExpression systems (E. coli, yeast, etc.)
PurityMixed with other phage proteins>85% (SDS-PAGE)
ModificationsLimited to viral processingCan include tags (Avi-tag, biotinylation)
ApplicationsLimited to natural functionExpanded to protein display, biotechnology

When using recombinant G3P, researchers should verify that the protein has been properly folded with intact disulfide bridges, as these are critical for the structural integrity and function of the protein.

What expression systems are most suitable for producing functional recombinant G3P?

Multiple expression systems have been validated for G3P production, each offering different advantages depending on research requirements:

  • E. coli expression system: Provides high yield and is suitable for structural studies. The protein can be produced with various tags, including in vivo biotinylation using AviTag-BirA technology, which catalyzes amide linkage between biotin and the specific lysine of the AviTag .

  • Yeast expression system: Offers eukaryotic post-translational modifications that may be important for certain applications .

  • Baculovirus expression system: Provides high yield of correctly folded protein with post-translational modifications .

  • Mammalian cell expression system: Ensures mammalian-specific glycosylation patterns and post-translational modifications that might be crucial for interaction studies with mammalian proteins .

The choice of expression system should be guided by the specific downstream application. For basic structural studies, E. coli-expressed protein is typically sufficient, while applications requiring specific modifications may benefit from eukaryotic expression systems.

What methodological approaches should be used to study G3P-mediated phage infection?

Studying G3P-mediated phage infection requires a multidisciplinary approach combining structural, biochemical, and genetic techniques:

  • Structural analysis: NMR spectroscopy has been successfully employed to determine the solution structure of g3p-D1, revealing the six-stranded beta barrel topology and N-terminal alpha helix . X-ray crystallography can provide complementary information on protein-protein interactions with host factors.

  • Molecular interaction studies: Surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) can quantify binding kinetics and thermodynamics between G3P and host receptors, particularly the F-pilus and Tol complex components.

  • Genetic manipulation: Recombinant DNA techniques can be used to generate G3P variants with specific mutations or domain deletions. The "SOEing" PCR mutagenesis approach has been successfully used to modify phage proteins for functional studies .

  • Infection assays: Quantitative phage infection assays using E. coli strains with different F-pilus phenotypes can correlate structural features of G3P with infection efficiency.

How can G3P be optimized for phage display applications?

G3P is a primary fusion partner in phage display technology, making its optimization crucial for successful library construction. Key considerations include:

  • Vector design: Specialized vectors such as fth1 have been developed that express recombinant peptides as chimeric proteins on phage surfaces . These vectors maintain genetic stability while producing high titers of recombinant phages.

  • Domain selection: The N-terminal domain (g3p-D1) is typically used for phage display as it remains functional when fused to foreign peptides or proteins. When designing constructs, researchers should preserve the structural integrity of this domain.

  • Insertion site optimization: For optimal display, foreign sequences should be inserted at specific locations that don't disrupt protein folding or function. In vector construction, foreign DNA can be introduced three codons downstream from the leader peptide or at other strategic locations using "SOEing" PCR mutagenesis .

  • Expression control: Using regulated promoters like the tac promoter allows controlled expression of recombinant G3P . This can be achieved through vector engineering as demonstrated in the construction of the ftac88 vector.

  • Stability considerations: To ensure stable phage particles, constructs should include proper transcription terminators (like the HP terminator) and maintain the integrity of the intergenic region .

What structural features of G3P are conserved across different filamentous phages?

The structural conservation of G3P across filamentous phages has significant implications for understanding bacteriophage evolution and infection mechanisms:

Phage TypeG3P Domain StructureKey Structural FeaturesHost Specificity
Pseudomonas phage Pf1N-terminal infection domainSix-stranded beta barrel, N-terminal alpha helixPseudomonas with F-pilus
E. coli phage fdN-terminal (g3p-D1) and C-terminal domainsSix-stranded beta barrel in g3p-D1E. coli with F-pilus
E. coli phages Ike and 12-2Similar N-terminal domainsPredicted similar beta barrel structureE. coli with specific pili
Cholera toxin phage ctxφPredicted similar domainsPredicted similar beta barrel topologyVibrio cholerae

The presence of structurally similar domains across these diverse phages strongly suggests a conserved infection pathway despite significant evolutionary divergence . The resemblance of G3P domains to PTB and PDZ domains involved in eukaryotic signal transduction further suggests that these structures represent an effective solution to the problem of protein-protein interactions that has evolved independently in multiple contexts .

What are the critical buffer conditions for maintaining G3P stability in experimental settings?

The stability of recombinant G3P is critical for experimental success. Based on structural features including disulfide bridges and extensive hydrogen-bonding networks, the following buffer conditions are recommended:

  • Reconstitution: Lyophilized recombinant G3P should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Long-term storage: Addition of 5-50% glycerol (final concentration) followed by aliquoting and storage at -20°C/-80°C is recommended for preserved functionality .

  • Reducing agents: Since G3P contains critical disulfide bridges, reducing agents like DTT or β-mercaptoethanol should be avoided in storage and experimental buffers unless protein reduction is specifically required.

  • pH considerations: Neutral to slightly basic pH (7.0-8.0) buffers such as phosphate-buffered saline or Tris-HCl are recommended to maintain structural integrity.

  • Stability verification: Proper folding can be verified through circular dichroism (CD) spectroscopy to confirm secondary structure elements, particularly the beta barrel and alpha helix components.

How do mutations in G3P affect phage infectivity and host range?

Mutations in G3P can significantly alter phage infectivity and host specificity, making this an important area for researchers studying phage biology and phage-based applications:

  • N-terminal domain mutations: Alterations in the g3p-D1 domain can affect the phage's ability to interact with the Tol complex, thereby influencing penetration into host cells. Point mutations in the six-stranded beta barrel can disrupt the hydrogen-bond network critical for domain stability .

  • Disulfide bridge mutations: The two disulfide bridges in g3p-D1 are essential for maintaining stability in harsh extracellular environments. Mutations affecting these cysteine residues can dramatically reduce infectivity by destabilizing the protein structure .

  • Host-range expansion: Directed evolution approaches combining random mutagenesis of g3p with selection for altered host specificity can generate phage variants with expanded host ranges. This approach has applications in developing targeted phage therapies.

  • Functional assays: Phage infection efficiency can be quantitatively measured using plaque assays with various host strains to correlate specific mutations with changes in infectivity or host range.

How can G3P be incorporated into synthetic biology applications?

The unique properties of G3P make it valuable for various synthetic biology applications:

  • Bioconjugation platforms: The in vivo biotinylation capability of G3P using AviTag-BirA technology enables site-specific attachment to streptavidin-coated surfaces or nanoparticles . This allows for oriented immobilization of fusion proteins.

  • Targeted delivery systems: By fusing therapeutic proteins or peptides to G3P, researchers can create phage-inspired delivery vehicles that target specific bacterial populations or cell types.

  • Biosensor development: The stable scaffold of G3P's N-terminal domain can be engineered to display sensing elements that undergo conformational changes upon analyte binding, creating the basis for novel biosensors.

  • Assembly of protein complexes: Leveraging the modular nature of phage display vectors like fth1 , researchers can create programmable protein assemblies for materials science applications.

What strategies can optimize G3P production and purification for structural studies?

Obtaining high-quality G3P for structural studies requires optimization of expression and purification protocols:

  • Expression optimization:

    • For E. coli expression: BL21(DE3) or similar strains grown at lower temperatures (16-25°C) after induction can improve proper folding.

    • For eukaryotic systems: Baculovirus expression in insect cells often provides the best balance of yield and proper folding for structural studies.

  • Purification strategy:

    • IMAC (Immobilized Metal Affinity Chromatography) using histidine tags is effective for initial capture.

    • Size exclusion chromatography as a polishing step ensures removal of aggregates and dimers.

    • For highest purity (>95%), ion exchange chromatography may be added as an intermediate step.

  • Tag considerations:

    • While tags facilitate purification, they may interfere with structural studies.

    • TEV or PreScission protease cleavage sites can be incorporated to remove tags after purification.

    • For NMR studies, isotopic labeling (15N, 13C) can be efficiently incorporated using minimal media in E. coli expression systems.

  • Quality control:

    • SDS-PAGE under reducing and non-reducing conditions can verify disulfide bond formation.

    • Mass spectrometry confirms protein integrity and modifications.

    • Circular dichroism spectroscopy verifies secondary structure elements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.