Recombinant Pseudomonas phage Pf1 Head virion protein G6P (VI)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Pseudomonas phage Pf1 Head virion protein G6P(VI) is a recombinant protein derived from the Pseudomonas phage Pf1 (Bacteriophage Pf1) . It is available in different sizes, with a standard size of 50 ug .

  • Species: Pseudomonas phage Pf1 (Bacteriophage Pf1)

  • UniProt Accession Number: Q38066

  • Storage Buffer: Tris-based buffer with 50% glycerol, optimized for the protein

  • Storage Conditions: Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Avoid repeated freezing and thawing. Working aliquots can be stored at 4℃ for up to one week .

  • Amino Acid Sequence: MEWLSGFLDQIIAFFQWIWDFFAQGIYDFVRDGLVVATKASMYAALQTLILLIDVSYTAARELIDSL

2.1. Phage Structure and Function

Bacteriophages, or phages, are viruses that infect bacteria. Pseudomonas phage Pf1 is a filamentous phage known to impact biofilm development, stress tolerance, virulence, and colony variants in Pseudomonas aeruginosa .

2.2. Head Virion Proteins

The head of a phage, also known as the capsid, is a protein shell that encapsulates the phage's genetic material . Head virion proteins, such as G6P(VI), are crucial for the assembly and stability of the phage head structure . These proteins play a vital role in protecting the phage DNA and facilitating its entry into the host cell during infection .

2.3. Role in Biofilm Formation

Filamentous phages like Pf1 influence biofilm formation in Pseudomonas aeruginosa . Biofilms are complex communities of bacteria embedded in a self-produced matrix, which enhances their resistance to antibiotics and host immune defenses. Studies have indicated that proteins like DppA1 can affect Pf5 prophage excision, further influencing biofilm formation .

3.3. Baseplate Proteins

Some phages utilize baseplate proteins, which form the central substrate hub and are associated with horizontal gene transfer . Additionally, baseplate wedge proteins facilitate the adhesion and penetration of the host cell membrane .

4.1. Impact on Biofilm Development

Research has demonstrated that filamentous phages significantly impact biofilm development . For instance, the inactivation of proteins like DppA1 can lead to a substantial reduction in biofilm formation . This occurs due to the increased excision of Pf5 prophage, which results in cell lysis .

4.2. DppA1 and Pf5 Prophage

DppA1, a substrate-binding protein, has been shown to repress Pf5 prophage excision . When DppA1 is inactivated, there is a significant increase in Pf5 excision and phage production, leading to reduced growth and increased cell lysis .

Table 1: Impact of DppA1 Inactivation on Pf5 Prophage Excision and Plaque Formation

FeatureWild-Type StraindppA1 Mutant
Pf5 Phage Excision0.00017%0.1% (600-fold increase)
Plaque Formation (pfu/mL)0.9 ± 0.5 × 10²1.5 ± 0.3 × 10⁸ (1.7 million-fold increase)

4.3. Phage JBD30 Baseplate Structure

The structure of phage baseplate proteins can provide insights into their function. For example, in Pseudomonas aeruginosa phage JBD30, the upper baseplate protein interacts with the baseplate hub and distal tail proteins, contributing to the stability and function of the baseplate .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VI; Head virion protein G6P; Coat protein D; G6P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Pseudomonas phage Pf1 (Bacteriophage Pf1)
Target Names
VI
Target Protein Sequence
MEWLSGFLDQIIAFFQWIWDFFAQGIYDFVRDGLVVATKASMYAALQTLILLIDVSYTAA RELIDSLGVPQMIRSMYAALPGPIAAGLAFFGVPQALNIIMGRGGDALLHALRAVHWEVI RVDQDPSRPQWLLQNLRRDPG
Uniprot No.

Target Background

Function

This protein plays crucial roles in both viral genome entry into the bacterial host and the viral budding process. The formation of the G3P-G6P complex, also known as the adsorption complex, is essential for the proper termination of filamentous phage assembly.

Database Links

KEGG: vg:1260701

Protein Families
Inovirus G6P protein family
Subcellular Location
Virion. Host membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of Pseudomonas phage Pf1 and where is G6P located?

Pseudomonas phage Pf1 is a filamentous bacteriophage with an exceptionally long and slender virion structure, measuring approximately 2000 nm in length and 7 nm in diameter . The phage capsid consists of small protein subunits, each only 46 amino acids in length, arranged to form a protective shell around the viral DNA . Within this structure, G6P functions as one of the minor capsid proteins, alongside G3P, G7P, and G9P, with approximately five copies of each present per virion capsid . The major capsid protein, G8P, is far more abundant with approximately 2,800 copies per capsid .

How does G6P contribute to the function of Pseudomonas phage Pf1?

While the specific contribution of G6P to Pf1 phage function is not fully characterized, it is known to be one of the minor capsid proteins essential for proper virion assembly and stability. The minor capsid proteins collectively play crucial roles in maintaining structural integrity and potentially in host interactions. By comparison, the better-characterized minor capsid protein G3P is responsible for recognition of host receptors, typically type IV pili, which facilitates phage infection of bacterial cells .

As part of the structural module of the phage genome, G6P likely contributes to the unique physicochemical properties of Pf1 phages, including their ability to form liquid crystal structures that enhance biofilm adhesion and tolerance to desiccation and cationic antibiotics . The precise molecular mechanisms by which G6P operates within this complex system remain an important area for continued research.

What are the notable physicochemical properties of Pf1 phage that might influence G6P protein function?

Pf1 phages represent long, negatively charged macromolecules with significant physicochemical properties that contribute to their biological activities. From a structural perspective, G6P exists within a highly organized capsid environment where:

  • The phage's high negative charge density allows interaction with host and bacterial biopolymers (including mucin, actin, DNA, and glycosaminoglycans)

  • These interactions facilitate assembly into structured liquid crystals that enhance biofilm adhesion

  • The phage structure demonstrates resistance to desiccation and cationic antibiotics

  • The capsid contains water "tunnels" through its highly hydrophobic regions, as demonstrated by solid-state NMR studies

These properties suggest that G6P functions within a complex molecular environment that facilitates both structural stability and functional interactions with host components. Understanding how G6P contributes to or is influenced by these properties represents an important research direction .

What experimental approaches are most effective for studying the structure-function relationship of recombinant G6P protein?

Studying the structure-function relationship of recombinant G6P requires a multi-technique approach:

When designing experiments to study G6P specifically, researchers should consider the known capsid organization of Pf1, where minor capsid proteins are present in limited copies (approximately 5 per virion) compared to the major capsid protein G8P (2,800 copies) . This abundance difference necessitates sensitive detection methods and potentially selective labeling strategies to distinguish G6P signal from other capsid components.

How do the two evolutionary lineages of Pf phages (I and II) differ in their G6P protein composition and function?

Pseudomonas filamentous (Pf) phages exist in two distinct evolutionary lineages (I and II) with substantial differences in their structural and morphogenesis properties, despite sharing integration sites in host chromosomes .

Comparative analysis of G6P proteins between these lineages reveals:

  • Lineage I (including model phages Pf1, Pf4, and Pf5) has been extensively studied and characterized

  • Lineage II remains comparatively underexplored but likely employs different structural strategies

  • While both lineages maintain similar genomic organization, the specific sequence conservation of G6P between lineages remains to be fully characterized

Research gaps exist in directly comparing G6P proteins between these lineages, particularly regarding:

  • Amino acid sequence conservation and variation

  • Structural differences that might impact capsid assembly

  • Potential functional divergence that could influence host range or infection dynamics

Methodologically, researchers investigating these differences should employ comparative genomics, structural biology approaches, and functional assays to determine how G6P variants contribute to the distinct properties of each lineage .

What role might G6P play in the formation of liquid crystal structures observed in Pf phage biofilms?

Pf phages can form highly structured liquid crystals that enhance biofilm adhesion and provide protection against environmental stresses . While the specific contribution of G6P to this phenomenon has not been fully elucidated, several mechanistic hypotheses warrant investigation:

To investigate these possibilities, researchers might employ:

  • Recombinant G6P variants with altered charge properties to assess impact on liquid crystal formation

  • Microscopy techniques (polarized light microscopy, confocal microscopy) to visualize liquid crystal structures in the presence of wild-type versus modified G6P

  • Biophysical measurements of phage-biofilm interactions with and without functional G6P

Understanding G6P's role in liquid crystal formation has significant implications for bacterial pathogenicity, as these structures contribute to biofilm stability and antibiotic resistance .

What expression systems are most suitable for producing recombinant Pseudomonas phage Pf1 G6P protein?

The optimal expression system for recombinant G6P production must balance protein authenticity with yield. Based on structural knowledge of Pf1 phage and similar recombinant protein production systems:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21(DE3)High yield, simple cultivationPotential folding issuesUse low-temperature induction (16-18°C); consider fusion tags
Pseudomonas speciesNative folding environmentLower yields, more complex handlingOptimize codon usage; use homologous promoters
Cell-free systemsAvoids toxicity issuesHigher cost, lower scalabilityPre-screen conditions; supplement with chaperones
Yeast expressionPost-translational modificationsMay introduce non-native modificationsEngineer minimal glycosylation strains

When designing an expression construct for G6P, researchers should consider:

  • The small size of native G6P may benefit from fusion partners to improve stability and expression

  • Inclusion of a cleavable affinity tag for purification

  • Codon optimization based on the expression host

  • Signal sequences if secretion is desired

For verification of properly folded recombinant G6P, structural analysis via circular dichroism spectroscopy can confirm secondary structure elements, while functional assays might include assessment of oligomerization or interactions with other phage components.

What purification challenges are specific to recombinant G6P protein and how can they be addressed?

Purifying recombinant G6P presents several challenges stemming from its small size, potential hydrophobicity, and native oligomeric state:

  • Solubility Issues:

    • Challenge: G6P may form inclusion bodies or aggregate during expression

    • Solution: Use solubility-enhancing fusion partners (MBP, SUMO, thioredoxin) with cleavable linkers

    • Validation: Monitor soluble fraction via SDS-PAGE during optimization

  • Purification Strategy:

    • Primary capture: Immobilized metal affinity chromatography (IMAC) using histidine tags

    • Intermediate purification: Ion exchange chromatography exploiting the protein's charge properties

    • Polishing: Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Optional: Affinity tag removal using site-specific proteases if necessary for functional studies

  • Quality Control Metrics:

    • Purity assessment: SDS-PAGE, mass spectrometry

    • Structural integrity: Circular dichroism, intrinsic fluorescence

    • Homogeneity: Dynamic light scattering, analytical ultracentrifugation

    • Functionality: Binding assays with other phage components or host receptors

  • Storage Considerations:

    • Buffer optimization to prevent aggregation

    • Flash freezing in small aliquots to avoid freeze-thaw cycles

    • Stability testing at various temperatures and timepoints

For researchers encountering persistent solubility issues, alternative approaches include:

  • Detergent screening to identify conditions promoting solubility

  • Refolding protocols from solubilized inclusion bodies

  • Co-expression with chaperone proteins

How can researchers effectively study interactions between G6P and other phage capsid proteins?

Understanding the interactions between G6P and other capsid proteins is crucial for elucidating its role in phage assembly and function. Several complementary methodologies are recommended:

  • In vitro Binding Assays:

    • Pull-down assays using recombinant tagged versions of G6P and potential binding partners

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) for quantitative binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

  • Structural Studies of Protein Complexes:

    • Crosslinking mass spectrometry to identify interaction interfaces

    • Single-particle cryo-EM of reconstituted subcomplexes

    • NMR studies using selectively labeled proteins to monitor binding interactions

  • In vivo Interaction Validation:

    • Bacterial two-hybrid systems adapted for membrane/capsid proteins

    • Fluorescence resonance energy transfer (FRET) between tagged capsid components

    • Co-immunoprecipitation from phage-infected cells

  • Computational Approaches:

    • Molecular docking simulations to predict interaction interfaces

    • Molecular dynamics to assess stability of predicted complexes

    • Evolutionary coupling analysis to identify co-evolving residues between G6P and other capsid proteins

When designing interaction studies, researchers should consider that G6P likely interacts with both major (G8P) and other minor capsid proteins (G3P, G7P, G9P) to form a functional virion structure . The stoichiometry of these interactions (5 copies of each minor capsid protein versus 2,800 copies of G8P) presents both challenges and opportunities for selective detection strategies.

How might understanding G6P contribute to developing new anti-Pseudomonas strategies?

Pseudomonas aeruginosa filamentous phages contribute significantly to bacterial pathogenicity, biofilm formation, and antibiotic resistance . Understanding G6P's role in these processes could inform novel therapeutic approaches:

  • Targeting Biofilm Formation:

    • Pf phages form liquid crystal structures that enhance biofilm adhesion and antibiotic tolerance

    • If G6P contributes to these structures, inhibitors targeting G6P could potentially disrupt biofilm formation

    • Research direction: Identify specific G6P domains involved in these processes through systematic mutagenesis

  • Phage-Based Diagnostics:

    • Pf phages have been proposed as potential biomarkers for risk of antibiotic resistance development

    • G6P-specific detection systems could potentially improve diagnostic specificity

    • Research approach: Develop G6P-targeted immunoassays or nucleic acid detection methods

  • Immunomodulation Strategies:

    • Pf phages suppress bacterial phagocytosis by macrophages, contributing to immune evasion

    • Understanding whether G6P participates in this process could inform immunomodulatory therapies

    • Experimental approach: Compare immune responses to wild-type phage versus G6P-deficient variants

The significance of this research extends beyond basic virology, as Pf phages impact multiple aspects of P. aeruginosa pathogenicity. They regulate biofilm development and structural integrity , influence bacterial invasiveness and inflammatory responses , and affect the formation of small colony variants with enhanced biofilm capabilities and antibiotic resistance .

What techniques can researchers use to assess G6P's contribution to phage assembly and stability?

To evaluate G6P's role in phage assembly and stability, researchers can employ several complementary approaches:

  • Genetic Approaches:

    • Site-directed mutagenesis of key G6P residues to identify those critical for assembly

    • Conditional knockdown or deletion systems to control G6P expression

    • Complementation studies with variant G6P proteins

  • Biochemical Stability Assays:

    • Comparative thermal stability analysis of wild-type versus G6P-modified phage particles

    • Resistance to chemical denaturants (urea, guanidinium hydrochloride)

    • Protease susceptibility assays to probe capsid integrity

  • Structural Analysis Techniques:

    TechniqueInformation ProvidedSample Requirements
    Negative-stain EMGross morphological changesPurified phage particles
    Cryo-EMHigh-resolution structural detailsConcentrated, highly pure samples
    Atomic force microscopyMechanical properties, surface topologySurface-immobilized particles
    Solid-state NMRAtomic-level structural changesIsotopically labeled samples
  • Functional Impact Assessment:

    • Infectivity assays comparing wild-type and G6P-modified phages

    • Biofilm formation assays to assess functional consequences

    • Liquid crystal formation capacity with modified G6P variants

When designing these experiments, researchers should consider the natural hydration patterns of the Pf1 capsid, which includes water "tunnels" through the hydrophobic regions . These water channels may play important roles in capsid stability and function, potentially involving G6P in maintaining proper hydration structure.

How does the hydration pattern of Pf1 phage impact G6P function and experimental approaches?

The hydration structure of Pf1 bacteriophage represents a unique aspect of its biology with significant implications for G6P function and experimental design:

  • Hydration Patterns in Pf1 Capsid:

    • Solid-state NMR studies have revealed the presence of water "tunnels" through highly hydrophobic regions of the capsid

    • The virion demonstrates higher hydration levels than expected for average proteins, with a ratio of external to internal hydration water of approximately 3:1

    • These water molecules are in contact with both the coat protein and the DNA near the virion axis

  • Implications for G6P Function:

    • G6P likely interacts with this structured water network, potentially contributing to capsid stability

    • Water-mediated interactions may facilitate communication between external and internal environments

    • The hydration state may influence conformational dynamics of G6P within the capsid

  • Experimental Considerations:

    • Sample preparation protocols must carefully control hydration levels to maintain native structure

    • Dehydration during experimental procedures may artificially alter G6P conformation or interactions

    • Recombinant G6P studies should account for the natural hydration environment when assessing function

  • Advanced Methodological Approaches:

    • Magic angle spinning solid-state NMR techniques can characterize G6P-water interactions with atomic precision

    • HETCOR (heteronuclear correlation) experiments can map specific amino acid contacts with hydration water

    • Molecular dynamics simulations incorporating explicit water molecules can predict hydration-dependent conformational changes

What are the most promising future research directions regarding G6P's role in Pseudomonas phage biology?

Several high-priority research avenues regarding G6P merit further investigation:

  • Comparative Analysis Between Lineages:

    • Characterize G6P structural and functional differences between Pf phage evolutionary lineages I and II

    • This could reveal adaptations that contribute to host specificity or environmental persistence

    • Methodology: Comparative genomics, structural biology, and functional assays across diverse Pf phage isolates

  • Role in Pathogenesis Mechanisms:

    • Investigate whether G6P contributes to the immunomodulatory effects of Pf phages

    • Determine if G6P influences biofilm formation capabilities or antibiotic resistance

    • Approach: Generate G6P variants and assess their impact on virulence-associated phenotypes

  • Structural Biology Frontiers:

    • Obtain high-resolution structures of G6P alone and in complex with other capsid components

    • Map the orientation and positioning of G6P within the intact virion

    • Techniques: Advanced cryo-EM, X-ray crystallography, and integrative structural biology approaches

  • Biotechnological Applications:

    • Explore G6P as a potential component for phage display or nanoparticle design

    • Assess whether engineered G6P variants could alter phage tropism or payload delivery

    • Development path: Structure-guided protein engineering followed by functional validation

The significance of these research directions extends beyond basic virology, as understanding G6P may contribute to novel antimicrobial strategies targeting P. aeruginosa infections, which remain challenging to treat due to intrinsic and acquired antibiotic resistance mechanisms .

What technical challenges remain in studying recombinant G6P and how might they be overcome?

Despite advances in protein science, several technical challenges persist in G6P research:

  • Structural Determination Limitations:

    • Challenge: Obtaining sufficient quantities of properly folded recombinant G6P

    • Solution approach: Explore novel fusion partners specifically designed for small viral proteins

    • Alternative: In situ structural characterization within intact phage particles using advanced imaging

  • Functional Reconstitution:

    • Challenge: Recreating the native environment for functional studies

    • Approach: Develop minimal reconstitution systems with defined components

    • Innovation opportunity: Artificial membrane systems mimicking the phage-host interface

  • Detection Sensitivity:

    • Challenge: Distinguishing G6P signal from other capsid components

    • Solution: Site-specific labeling strategies for selective detection

    • Advanced approach: Single-molecule techniques to observe individual G6P molecules

  • Computational Limitations:

    • Challenge: Accurate modeling of G6P in its native environment

    • Approach: Develop specialized force fields for filamentous phage components

    • Integration strategy: Combine experimental constraints with simulation to improve accuracy

These challenges present opportunities for methodological innovation. Researchers might consider forming collaborative networks to share specialized techniques and resources, potentially accelerating progress in understanding this important component of Pf1 phage biology.

How does current knowledge of G6P integrate with our broader understanding of filamentous phage biology?

G6P represents an important yet understudied component within the broader context of filamentous phage biology. Current knowledge positions G6P within several key frameworks:

  • Evolutionary Context:
    As part of the diverse family of filamentous phages with two distinct lineages, G6P likely underwent evolutionary adaptations that contribute to the specialized properties of Pf phages . Understanding these adaptations provides insight into phage evolution and host-pathogen co-evolution.

  • Structural Biology Perspective:
    G6P functions within the complex architecture of the Pf1 virion, which includes a highly organized capsid with defined hydration patterns and electrostatic properties . This structural context influences how we interpret G6P function and design experiments to study it.

  • Bacterial Pathogenesis Framework:
    Pf phages contribute significantly to P. aeruginosa virulence, biofilm formation, and antibiotic resistance . Determining G6P's specific contributions to these phenomena will enhance our understanding of bacterial pathogenesis mechanisms.

  • Biotechnology Applications:
    Knowledge of G6P structure and function could inform the development of phage-based biotechnology applications, including targeted drug delivery systems, diagnostic tools, and antimicrobial strategies.

Integration of these perspectives provides a comprehensive framework for G6P research that connects molecular mechanisms to biological functions and potential applications. This integrated approach will be essential for addressing the remaining knowledge gaps in our understanding of this important phage protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.