Recombinant Pseudomonas phage Pf1 Head virion protein G6P(VI) is a recombinant protein derived from the Pseudomonas phage Pf1 (Bacteriophage Pf1) . It is available in different sizes, with a standard size of 50 ug .
Storage Buffer: Tris-based buffer with 50% glycerol, optimized for the protein
Storage Conditions: Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Avoid repeated freezing and thawing. Working aliquots can be stored at 4℃ for up to one week .
Amino Acid Sequence: MEWLSGFLDQIIAFFQWIWDFFAQGIYDFVRDGLVVATKASMYAALQTLILLIDVSYTAARELIDSL
Bacteriophages, or phages, are viruses that infect bacteria. Pseudomonas phage Pf1 is a filamentous phage known to impact biofilm development, stress tolerance, virulence, and colony variants in Pseudomonas aeruginosa .
The head of a phage, also known as the capsid, is a protein shell that encapsulates the phage's genetic material . Head virion proteins, such as G6P(VI), are crucial for the assembly and stability of the phage head structure . These proteins play a vital role in protecting the phage DNA and facilitating its entry into the host cell during infection .
Filamentous phages like Pf1 influence biofilm formation in Pseudomonas aeruginosa . Biofilms are complex communities of bacteria embedded in a self-produced matrix, which enhances their resistance to antibiotics and host immune defenses. Studies have indicated that proteins like DppA1 can affect Pf5 prophage excision, further influencing biofilm formation .
Some phages utilize baseplate proteins, which form the central substrate hub and are associated with horizontal gene transfer . Additionally, baseplate wedge proteins facilitate the adhesion and penetration of the host cell membrane .
Research has demonstrated that filamentous phages significantly impact biofilm development . For instance, the inactivation of proteins like DppA1 can lead to a substantial reduction in biofilm formation . This occurs due to the increased excision of Pf5 prophage, which results in cell lysis .
DppA1, a substrate-binding protein, has been shown to repress Pf5 prophage excision . When DppA1 is inactivated, there is a significant increase in Pf5 excision and phage production, leading to reduced growth and increased cell lysis .
| Feature | Wild-Type Strain | dppA1 Mutant |
|---|---|---|
| Pf5 Phage Excision | 0.00017% | 0.1% (600-fold increase) |
| Plaque Formation (pfu/mL) | 0.9 ± 0.5 × 10² | 1.5 ± 0.3 × 10⁸ (1.7 million-fold increase) |
The structure of phage baseplate proteins can provide insights into their function. For example, in Pseudomonas aeruginosa phage JBD30, the upper baseplate protein interacts with the baseplate hub and distal tail proteins, contributing to the stability and function of the baseplate .
This protein plays crucial roles in both viral genome entry into the bacterial host and the viral budding process. The formation of the G3P-G6P complex, also known as the adsorption complex, is essential for the proper termination of filamentous phage assembly.
KEGG: vg:1260701
Pseudomonas phage Pf1 is a filamentous bacteriophage with an exceptionally long and slender virion structure, measuring approximately 2000 nm in length and 7 nm in diameter . The phage capsid consists of small protein subunits, each only 46 amino acids in length, arranged to form a protective shell around the viral DNA . Within this structure, G6P functions as one of the minor capsid proteins, alongside G3P, G7P, and G9P, with approximately five copies of each present per virion capsid . The major capsid protein, G8P, is far more abundant with approximately 2,800 copies per capsid .
While the specific contribution of G6P to Pf1 phage function is not fully characterized, it is known to be one of the minor capsid proteins essential for proper virion assembly and stability. The minor capsid proteins collectively play crucial roles in maintaining structural integrity and potentially in host interactions. By comparison, the better-characterized minor capsid protein G3P is responsible for recognition of host receptors, typically type IV pili, which facilitates phage infection of bacterial cells .
As part of the structural module of the phage genome, G6P likely contributes to the unique physicochemical properties of Pf1 phages, including their ability to form liquid crystal structures that enhance biofilm adhesion and tolerance to desiccation and cationic antibiotics . The precise molecular mechanisms by which G6P operates within this complex system remain an important area for continued research.
Pf1 phages represent long, negatively charged macromolecules with significant physicochemical properties that contribute to their biological activities. From a structural perspective, G6P exists within a highly organized capsid environment where:
The phage's high negative charge density allows interaction with host and bacterial biopolymers (including mucin, actin, DNA, and glycosaminoglycans)
These interactions facilitate assembly into structured liquid crystals that enhance biofilm adhesion
The phage structure demonstrates resistance to desiccation and cationic antibiotics
The capsid contains water "tunnels" through its highly hydrophobic regions, as demonstrated by solid-state NMR studies
These properties suggest that G6P functions within a complex molecular environment that facilitates both structural stability and functional interactions with host components. Understanding how G6P contributes to or is influenced by these properties represents an important research direction .
Studying the structure-function relationship of recombinant G6P requires a multi-technique approach:
When designing experiments to study G6P specifically, researchers should consider the known capsid organization of Pf1, where minor capsid proteins are present in limited copies (approximately 5 per virion) compared to the major capsid protein G8P (2,800 copies) . This abundance difference necessitates sensitive detection methods and potentially selective labeling strategies to distinguish G6P signal from other capsid components.
Pseudomonas filamentous (Pf) phages exist in two distinct evolutionary lineages (I and II) with substantial differences in their structural and morphogenesis properties, despite sharing integration sites in host chromosomes .
Comparative analysis of G6P proteins between these lineages reveals:
Lineage I (including model phages Pf1, Pf4, and Pf5) has been extensively studied and characterized
Lineage II remains comparatively underexplored but likely employs different structural strategies
While both lineages maintain similar genomic organization, the specific sequence conservation of G6P between lineages remains to be fully characterized
Research gaps exist in directly comparing G6P proteins between these lineages, particularly regarding:
Amino acid sequence conservation and variation
Structural differences that might impact capsid assembly
Potential functional divergence that could influence host range or infection dynamics
Methodologically, researchers investigating these differences should employ comparative genomics, structural biology approaches, and functional assays to determine how G6P variants contribute to the distinct properties of each lineage .
Pf phages can form highly structured liquid crystals that enhance biofilm adhesion and provide protection against environmental stresses . While the specific contribution of G6P to this phenomenon has not been fully elucidated, several mechanistic hypotheses warrant investigation:
To investigate these possibilities, researchers might employ:
Recombinant G6P variants with altered charge properties to assess impact on liquid crystal formation
Microscopy techniques (polarized light microscopy, confocal microscopy) to visualize liquid crystal structures in the presence of wild-type versus modified G6P
Biophysical measurements of phage-biofilm interactions with and without functional G6P
Understanding G6P's role in liquid crystal formation has significant implications for bacterial pathogenicity, as these structures contribute to biofilm stability and antibiotic resistance .
The optimal expression system for recombinant G6P production must balance protein authenticity with yield. Based on structural knowledge of Pf1 phage and similar recombinant protein production systems:
| Expression System | Advantages | Limitations | Optimization Strategies |
|---|---|---|---|
| E. coli BL21(DE3) | High yield, simple cultivation | Potential folding issues | Use low-temperature induction (16-18°C); consider fusion tags |
| Pseudomonas species | Native folding environment | Lower yields, more complex handling | Optimize codon usage; use homologous promoters |
| Cell-free systems | Avoids toxicity issues | Higher cost, lower scalability | Pre-screen conditions; supplement with chaperones |
| Yeast expression | Post-translational modifications | May introduce non-native modifications | Engineer minimal glycosylation strains |
When designing an expression construct for G6P, researchers should consider:
The small size of native G6P may benefit from fusion partners to improve stability and expression
Inclusion of a cleavable affinity tag for purification
Codon optimization based on the expression host
Signal sequences if secretion is desired
For verification of properly folded recombinant G6P, structural analysis via circular dichroism spectroscopy can confirm secondary structure elements, while functional assays might include assessment of oligomerization or interactions with other phage components.
Purifying recombinant G6P presents several challenges stemming from its small size, potential hydrophobicity, and native oligomeric state:
Solubility Issues:
Challenge: G6P may form inclusion bodies or aggregate during expression
Solution: Use solubility-enhancing fusion partners (MBP, SUMO, thioredoxin) with cleavable linkers
Validation: Monitor soluble fraction via SDS-PAGE during optimization
Purification Strategy:
Primary capture: Immobilized metal affinity chromatography (IMAC) using histidine tags
Intermediate purification: Ion exchange chromatography exploiting the protein's charge properties
Polishing: Size exclusion chromatography to remove aggregates and ensure homogeneity
Optional: Affinity tag removal using site-specific proteases if necessary for functional studies
Quality Control Metrics:
Purity assessment: SDS-PAGE, mass spectrometry
Structural integrity: Circular dichroism, intrinsic fluorescence
Homogeneity: Dynamic light scattering, analytical ultracentrifugation
Functionality: Binding assays with other phage components or host receptors
Storage Considerations:
Buffer optimization to prevent aggregation
Flash freezing in small aliquots to avoid freeze-thaw cycles
Stability testing at various temperatures and timepoints
For researchers encountering persistent solubility issues, alternative approaches include:
Detergent screening to identify conditions promoting solubility
Refolding protocols from solubilized inclusion bodies
Co-expression with chaperone proteins
Understanding the interactions between G6P and other capsid proteins is crucial for elucidating its role in phage assembly and function. Several complementary methodologies are recommended:
In vitro Binding Assays:
Pull-down assays using recombinant tagged versions of G6P and potential binding partners
Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) for quantitative binding kinetics
Isothermal titration calorimetry (ITC) for thermodynamic binding parameters
Structural Studies of Protein Complexes:
Crosslinking mass spectrometry to identify interaction interfaces
Single-particle cryo-EM of reconstituted subcomplexes
NMR studies using selectively labeled proteins to monitor binding interactions
In vivo Interaction Validation:
Bacterial two-hybrid systems adapted for membrane/capsid proteins
Fluorescence resonance energy transfer (FRET) between tagged capsid components
Co-immunoprecipitation from phage-infected cells
Computational Approaches:
Molecular docking simulations to predict interaction interfaces
Molecular dynamics to assess stability of predicted complexes
Evolutionary coupling analysis to identify co-evolving residues between G6P and other capsid proteins
When designing interaction studies, researchers should consider that G6P likely interacts with both major (G8P) and other minor capsid proteins (G3P, G7P, G9P) to form a functional virion structure . The stoichiometry of these interactions (5 copies of each minor capsid protein versus 2,800 copies of G8P) presents both challenges and opportunities for selective detection strategies.
Pseudomonas aeruginosa filamentous phages contribute significantly to bacterial pathogenicity, biofilm formation, and antibiotic resistance . Understanding G6P's role in these processes could inform novel therapeutic approaches:
Targeting Biofilm Formation:
Pf phages form liquid crystal structures that enhance biofilm adhesion and antibiotic tolerance
If G6P contributes to these structures, inhibitors targeting G6P could potentially disrupt biofilm formation
Research direction: Identify specific G6P domains involved in these processes through systematic mutagenesis
Phage-Based Diagnostics:
Immunomodulation Strategies:
The significance of this research extends beyond basic virology, as Pf phages impact multiple aspects of P. aeruginosa pathogenicity. They regulate biofilm development and structural integrity , influence bacterial invasiveness and inflammatory responses , and affect the formation of small colony variants with enhanced biofilm capabilities and antibiotic resistance .
To evaluate G6P's role in phage assembly and stability, researchers can employ several complementary approaches:
Genetic Approaches:
Site-directed mutagenesis of key G6P residues to identify those critical for assembly
Conditional knockdown or deletion systems to control G6P expression
Complementation studies with variant G6P proteins
Biochemical Stability Assays:
Comparative thermal stability analysis of wild-type versus G6P-modified phage particles
Resistance to chemical denaturants (urea, guanidinium hydrochloride)
Protease susceptibility assays to probe capsid integrity
Structural Analysis Techniques:
Functional Impact Assessment:
Infectivity assays comparing wild-type and G6P-modified phages
Biofilm formation assays to assess functional consequences
Liquid crystal formation capacity with modified G6P variants
When designing these experiments, researchers should consider the natural hydration patterns of the Pf1 capsid, which includes water "tunnels" through the hydrophobic regions . These water channels may play important roles in capsid stability and function, potentially involving G6P in maintaining proper hydration structure.
The hydration structure of Pf1 bacteriophage represents a unique aspect of its biology with significant implications for G6P function and experimental design:
Hydration Patterns in Pf1 Capsid:
Solid-state NMR studies have revealed the presence of water "tunnels" through highly hydrophobic regions of the capsid
The virion demonstrates higher hydration levels than expected for average proteins, with a ratio of external to internal hydration water of approximately 3:1
These water molecules are in contact with both the coat protein and the DNA near the virion axis
Implications for G6P Function:
G6P likely interacts with this structured water network, potentially contributing to capsid stability
Water-mediated interactions may facilitate communication between external and internal environments
The hydration state may influence conformational dynamics of G6P within the capsid
Experimental Considerations:
Sample preparation protocols must carefully control hydration levels to maintain native structure
Dehydration during experimental procedures may artificially alter G6P conformation or interactions
Recombinant G6P studies should account for the natural hydration environment when assessing function
Advanced Methodological Approaches:
Magic angle spinning solid-state NMR techniques can characterize G6P-water interactions with atomic precision
HETCOR (heteronuclear correlation) experiments can map specific amino acid contacts with hydration water
Molecular dynamics simulations incorporating explicit water molecules can predict hydration-dependent conformational changes
Several high-priority research avenues regarding G6P merit further investigation:
Comparative Analysis Between Lineages:
Characterize G6P structural and functional differences between Pf phage evolutionary lineages I and II
This could reveal adaptations that contribute to host specificity or environmental persistence
Methodology: Comparative genomics, structural biology, and functional assays across diverse Pf phage isolates
Role in Pathogenesis Mechanisms:
Investigate whether G6P contributes to the immunomodulatory effects of Pf phages
Determine if G6P influences biofilm formation capabilities or antibiotic resistance
Approach: Generate G6P variants and assess their impact on virulence-associated phenotypes
Structural Biology Frontiers:
Obtain high-resolution structures of G6P alone and in complex with other capsid components
Map the orientation and positioning of G6P within the intact virion
Techniques: Advanced cryo-EM, X-ray crystallography, and integrative structural biology approaches
Biotechnological Applications:
Explore G6P as a potential component for phage display or nanoparticle design
Assess whether engineered G6P variants could alter phage tropism or payload delivery
Development path: Structure-guided protein engineering followed by functional validation
The significance of these research directions extends beyond basic virology, as understanding G6P may contribute to novel antimicrobial strategies targeting P. aeruginosa infections, which remain challenging to treat due to intrinsic and acquired antibiotic resistance mechanisms .
Despite advances in protein science, several technical challenges persist in G6P research:
Structural Determination Limitations:
Challenge: Obtaining sufficient quantities of properly folded recombinant G6P
Solution approach: Explore novel fusion partners specifically designed for small viral proteins
Alternative: In situ structural characterization within intact phage particles using advanced imaging
Functional Reconstitution:
Challenge: Recreating the native environment for functional studies
Approach: Develop minimal reconstitution systems with defined components
Innovation opportunity: Artificial membrane systems mimicking the phage-host interface
Detection Sensitivity:
Challenge: Distinguishing G6P signal from other capsid components
Solution: Site-specific labeling strategies for selective detection
Advanced approach: Single-molecule techniques to observe individual G6P molecules
Computational Limitations:
Challenge: Accurate modeling of G6P in its native environment
Approach: Develop specialized force fields for filamentous phage components
Integration strategy: Combine experimental constraints with simulation to improve accuracy
These challenges present opportunities for methodological innovation. Researchers might consider forming collaborative networks to share specialized techniques and resources, potentially accelerating progress in understanding this important component of Pf1 phage biology.
G6P represents an important yet understudied component within the broader context of filamentous phage biology. Current knowledge positions G6P within several key frameworks:
Evolutionary Context:
As part of the diverse family of filamentous phages with two distinct lineages, G6P likely underwent evolutionary adaptations that contribute to the specialized properties of Pf phages . Understanding these adaptations provides insight into phage evolution and host-pathogen co-evolution.
Structural Biology Perspective:
G6P functions within the complex architecture of the Pf1 virion, which includes a highly organized capsid with defined hydration patterns and electrostatic properties . This structural context influences how we interpret G6P function and design experiments to study it.
Bacterial Pathogenesis Framework:
Pf phages contribute significantly to P. aeruginosa virulence, biofilm formation, and antibiotic resistance . Determining G6P's specific contributions to these phenomena will enhance our understanding of bacterial pathogenesis mechanisms.
Biotechnology Applications:
Knowledge of G6P structure and function could inform the development of phage-based biotechnology applications, including targeted drug delivery systems, diagnostic tools, and antimicrobial strategies.
Integration of these perspectives provides a comprehensive framework for G6P research that connects molecular mechanisms to biological functions and potential applications. This integrated approach will be essential for addressing the remaining knowledge gaps in our understanding of this important phage protein.