Recombinant Pseudomonas phage Pf1 Uncharacterized protein ORF430

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Pseudomonas phage Pf1 Uncharacterized protein ORF430 (UniProt ID: P25130) is a full-length recombinant protein derived from the filamentous bacteriophage Pf1, which infects Pseudomonas aeruginosa. This protein is expressed in Escherichia coli with an N-terminal histidine (His) tag for purification and characterization. Despite its classification as "uncharacterized," ORF430 has been studied in the context of phage biology and bacterial pathogenesis, particularly in engineered phage systems for therapeutic applications .

Gene and Protein Information

AttributeDetail
Gene NameORF430
Protein LengthFull-length (1–430 amino acids)
Source OrganismPseudomonas phage Pf1
Expression HostE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles

Role in Phage Engineering

ORF430 was replaced with the BglIIR gene in a recombinant phage (Pf3R) to create a nonreplicating, nonlytic phage for therapeutic use. This engineering:

  1. Disrupted phage replication: BglIIR does not cleave Pf3 DNA, rendering the phage nonreplicative in wild-type P. aeruginosa .

  2. Killed bacteria: Pf3R delivered BglIIR, which introduced double-strand breaks in bacterial DNA, effectively killing P. aeruginosa PAO1 .

  3. Genetic stability: Pf3R remained stable over 10 passages on a host expressing the BglII methylase gene, ensuring consistent therapeutic efficacy .

Functional Insights

While ORF430’s exact role remains unclear, its replacement suggests involvement in:

  • Phage export: ORF430 may encode an export protein critical for phage release .

  • Replication regulation: Potential interaction with replication machinery or host factors influencing phage lifecycle .

Uncharacterized Nature

  • Host-pathogen interactions: Pf phages contribute to P. aeruginosa biofilm formation and virulence .

  • Phage lifecycle control: Pf phages switch between lysogenic and lytic cycles based on host stress (e.g., oxidative stress) .

Therapeutic Relevance

ORF430’s engineering in Pf3R demonstrates its utility in developing targeted antimicrobial agents. This approach leverages phage-derived proteins to disrupt bacterial DNA without causing host cell lysis, a strategy with potential for treating antibiotic-resistant infections .

Future Directions

  1. Functional Characterization: Determine ORF430’s role in phage export or replication through knockout studies.

  2. Interaction Mapping: Identify host or phage proteins interacting with ORF430 to elucidate its mechanisms.

  3. Therapeutic Optimization: Explore ORF430-based phage systems for targeting P. aeruginosa in cystic fibrosis or wound infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Uncharacterized protein ORF430; ORF430
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-430
Protein Length
full length protein
Species
Pseudomonas phage Pf1 (Bacteriophage Pf1)
Target Protein Sequence
MKTPIHPTRLVLEENGDFHKSPKGMLFMDPLNGQFTDLSGVRILRCGVDTVRQLYNGKLR PEVMALFDLSVDVVEFAGYEWSKGRIGRDSGYQYRLQNAEMGLILLIKNHNIKVDTIGSH LKIEVSPHAIDGADPRILQGVLDDLAAAVLSHCETNQAAVHIALDVQGWTPPADLVDRMH CRSRRVRQISGIERIEFDGNASVYGRGETYMFGSANGLQLSIYNKTLQARATDKLDYWES VWATLNGDPFGDGDPAYNPLETVWRIEFRYHHSIVQQFSEGSRMASGEVIGCRTYEGLCP HLQGLWNYACEAFRVLSREGMYDAFWSLISLDARVQVECDPLIERTEYRRYYKTAKGFSG RNCEMFLGQFVSLIARERVPAKKAIESARKLEFWHVIEDHYLAKGWTRRDLERHIHKLMC DRYLRKGYAI
Uniprot No.

Target Background

Function

May play a role in phage assembly.

Database Links

KEGG: vg:1260708

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

How does Pseudomonas phage Pf1 relate to the broader landscape of Pseudomonas phages?

Pseudomonas phage Pf1 belongs to the filamentous phage family that infects Pseudomonas aeruginosa. This contextual understanding is essential for researchers working with ORF430:

Understanding this broader context is crucial for developing hypotheses about the potential role of ORF430 within the phage life cycle and host-phage interactions.

What are the optimal expression and purification methods for obtaining recombinant ORF430?

Based on established protocols for recombinant ORF430 production, the following methodology has proven effective:

  • Expression system: E. coli has been successfully used as a host for the heterologous expression of ORF430 with an N-terminal His-tag .

  • Purification strategy: Standard His-tag affinity chromatography is suitable for initial purification, followed by additional chromatographic steps if higher purity is required.

  • Quality assessment: SDS-PAGE analysis is recommended to verify protein purity, with commercial preparations typically achieving >90% purity .

  • Yield considerations: While specific yield data is not available in the provided literature, optimization of expression conditions (temperature, induction timing, media composition) should be performed to maximize protein production.

For researchers developing their own expression systems, it is advisable to explore codon optimization for E. coli expression and consider solubility-enhancing fusion partners if initial expression attempts result in insoluble protein.

What are the critical parameters for handling and storage of recombinant ORF430?

Proper handling and storage of recombinant ORF430 is crucial for maintaining protein integrity and activity:

ParameterRecommended ConditionsNotes
Long-term storage-20°C to -80°CAliquoting necessary to avoid repeated freeze-thaw cycles
Working storage4°CLimited to approximately one week
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0For lyophilized preparations
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Brief centrifugation prior to opening recommended
StabilizationAddition of 5-50% glycerol (final concentration)50% glycerol is standard for commercial preparations

Critical considerations:

  • Repeated freeze-thaw cycles significantly reduce protein stability and should be strictly avoided

  • Working aliquots should not be stored for more than one week at 4°C

  • Centrifugation of vials prior to opening is recommended to bring contents to the bottom

How can researchers assess the structural integrity and functional activity of ORF430?

  • Structural integrity assessment:

    • SDS-PAGE to verify molecular weight and purity

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Size exclusion chromatography to assess aggregation state

    • Thermal shift assays to determine protein stability

  • Functional characterization approaches:

    • Pull-down assays to identify potential interaction partners

    • In vitro binding studies with Pseudomonas cellular components

    • Co-immunoprecipitation experiments if antibodies are available

    • Structural studies (X-ray crystallography, cryo-EM) to determine three-dimensional structure

  • In vivo studies:

    • Complementation studies in Pf1 phage with ORF430 deletions (if viability permits)

    • Localization studies using fluorescently tagged variants

    • Host response studies upon introduction of purified ORF430

Due to the uncharacterized nature of ORF430, researchers are encouraged to design experiments that can help elucidate its function within the phage life cycle.

What approaches can be used to identify potential functional roles of the uncharacterized ORF430?

For comprehensive functional characterization of ORF430, researchers should consider multi-faceted approaches:

  • Comparative genomics and bioinformatics:

    • Sequence comparison with characterized proteins across phage families

    • Structural prediction algorithms to identify potential functional domains

    • Phylogenetic analysis to trace evolutionary relationships

    • Protein-protein interaction network prediction

  • High-throughput experimental approaches:

    • Protein microarray analysis to identify binding partners

    • Phage display to determine binding epitopes

    • Mass spectrometry-based interaction studies

    • Targeted selection and parallel reaction monitoring (SRM/PRM) for protein quantification in complex samples

  • Gene knockout/complementation studies:

    • Generation of Pf1 phage variants with ORF430 deletions or mutations

    • Phenotypic analysis of resulting phage variants

    • Trans-complementation with recombinant ORF430

    • Dominant negative approaches using mutant variants

  • Structural biology:

    • X-ray crystallography or cryo-EM for atomic-level structure determination

    • NMR spectroscopy for dynamics analysis

    • Hydrogen-deuterium exchange mass spectrometry for conformational studies

Researchers should note that functional characterization may require integration of multiple approaches, as single techniques are unlikely to provide comprehensive insights for this uncharacterized protein.

How might ORF430 contribute to Pseudomonas phage-host interactions based on what we know about other Pf phage proteins?

While the specific function of ORF430 remains unknown, insights from studies on other Pf phages provide context for formulating research hypotheses:

  • Potential involvement in lysogeny maintenance:
    Studies of Pf prophages have identified specific genes like PflM (PA0718) that are essential for prophage integration. Deletion of such genes results in prophage excision. ORF430 might play a similar or complementary role in the Pf1 life cycle .

  • Possible role in virulence modulation:
    Pf phages significantly impact bacterial host phenotypes, including quorum sensing, biofilm formation, and virulence factor production. ORF430 could be involved in:

    • Modulating bacterial signaling pathways

    • Affecting biofilm matrix production

    • Altering expression of virulence factors

  • Structural considerations:
    Given the filamentous nature of Pf1 phage, ORF430 might serve as a:

    • Structural component of the virion

    • Assembly factor during phage morphogenesis

    • Packaging protein for phage genome

  • Host interaction possibilities:
    ORF430 could potentially interact with host cellular machinery to:

    • Manipulate host transcription or translation

    • Interfere with host defense mechanisms

    • Participate in phage DNA replication or integration

Researchers investigating ORF430 function should design experiments that test these hypothetical roles based on knowledge of phage biology and host-pathogen interactions.

What is the potential significance of ORF430 in understanding phage biology and applications?

Understanding ORF430's function has several important implications:

  • Fundamental phage biology:
    Characterizing ORF430 would contribute to understanding the complete genetic repertoire of Pf1 phage, potentially revealing novel mechanisms in filamentous phage biology.

  • Phage therapy applications:
    With growing interest in phage therapy against antibiotic-resistant Pseudomonas infections, understanding all phage components is critical. Insights into ORF430 function could:

    • Reveal targetable mechanisms for engineering improved therapeutic phages

    • Identify potential safety concerns for phage therapy applications

    • Provide markers for monitoring phage behavior in therapeutic contexts

  • Biotechnology applications:
    Filamentous phages have applications in:

    • Phage display technology

    • Nanomaterial development

    • Vaccine delivery systems
      ORF430 characterization might reveal properties useful for these applications.

  • Understanding bacterial virulence modulation:
    Pf phages significantly affect P. aeruginosa virulence. ORF430 might be part of the molecular machinery by which phages alter bacterial pathogenicity, providing potential targets for anti-virulence strategies .

What are common challenges when working with recombinant ORF430 and how can they be addressed?

Researchers working with recombinant ORF430 may encounter several challenges:

  • Protein solubility issues:

    • Problem: Recombinant expression resulting in inclusion bodies

    • Solutions:

      • Lower induction temperature (16-18°C)

      • Reduce inducer concentration

      • Co-express with chaperones

      • Use solubility-enhancing fusion tags (SUMO, MBP, TRX)

      • Optimize buffer conditions with stabilizing additives

  • Protein stability concerns:

    • Problem: Degradation during storage or experimental procedures

    • Solutions:

      • Strict adherence to storage recommendations (-20°C/-80°C with aliquoting)

      • Addition of protease inhibitors during purification and handling

      • Inclusion of stabilizing agents (glycerol, trehalose) in storage buffers

      • Minimization of freeze-thaw cycles

  • Protein aggregation:

    • Problem: Formation of non-functional aggregates

    • Solutions:

      • Addition of non-ionic detergents below critical micelle concentration

      • Inclusion of reducing agents if cysteine residues are present

      • Optimization of protein concentration

      • Centrifugation or filtration immediately before use

  • Detection difficulties:

    • Problem: Challenging protein detection in complex samples

    • Solutions:

      • Utilize the His-tag for detection with anti-His antibodies

      • Consider targeted mass spectrometry approaches like SRM/PRM

      • Develop custom antibodies against unique ORF430 epitopes

How can structural studies of ORF430 be optimized for success?

For researchers pursuing structural characterization of ORF430:

  • Sample preparation considerations:

    • Ensure highest purity (>95%) via multi-step chromatography

    • Verify monodispersity through dynamic light scattering

    • Identify the most stable buffer conditions through thermal shift assays

    • Remove His-tag if it causes flexibility issues (assess impact first)

  • Crystallization optimization:

    • Perform limited proteolysis to identify stable domains

    • Screen multiple crystallization conditions systematically

    • Consider surface entropy reduction mutations

    • Explore co-crystallization with potential binding partners

  • NMR considerations:

    • Isotopic labeling (15N, 13C) required for structural studies

    • Size limitations may necessitate domain-based approach

    • Optimize sample conditions to minimize aggregation

  • Cryo-EM approaches:

    • Size limitations may be challenging (ORF430 is relatively small)

    • Consider studying ORF430 in the context of larger complexes

    • Optimize grid preparation and vitrification conditions

How does the study of ORF430 relate to understanding Pseudomonas phage diversity and evolution?

Investigating ORF430 contributes to our broader understanding of phage biology:

  • Evolutionary perspective:

    • Sequence comparison across Pf phage variants reveals evolutionary relationships

    • Conservation analysis can identify functionally important regions

    • Phylogenetic analysis places ORF430 in context of phage protein evolution

  • Functional diversity:

    • Comparison with proteins of known function in other phages may reveal functional homologs

    • Identification of unique features specific to Pf1 phage could explain host specificity

    • Understanding whether ORF430 represents core or accessory phage genome

  • Host-phage co-evolution:

    • Investigating how ORF430 interacts with host factors may reveal co-evolutionary patterns

    • Comparison across Pseudomonas strains might explain host range determination

    • Analysis of selection pressure on ORF430 sequence can reveal host-pathogen dynamics

  • Contribution to phage classification:

    • Detailed characterization adds to the molecular definition of Pf1 phage

    • May provide markers for improved phage taxonomy

    • Could reveal unexpected relationships between phage families

How can researchers integrate ORF430 studies with broader investigations of Pf phage biology?

To maximize research impact, ORF430 studies should be integrated with broader Pf phage research:

  • Holistic phage biology approaches:

    • Study ORF430 in context of complete Pf1 lifecycle

    • Investigate potential interactions with other Pf1 proteins

    • Examine timing of ORF430 expression during infection cycle

  • Host response integration:

    • Measure impact of ORF430 on host transcriptome and proteome

    • Investigate host immune response to ORF430

    • Determine whether ORF430 affects host cell physiology

  • Phage-phage interactions:

    • Examine how ORF430 functions in bacterial hosts carrying multiple Pf prophages

    • Investigate potential complementation between ORF430 and proteins from other Pf phages

    • Study competitive or cooperative interactions between Pf1 and other phages

  • Translational research connections:

    • Connect basic ORF430 characterization to phage therapy applications

    • Explore biotechnological applications based on ORF430 properties

    • Investigate ORF430 as potential biomarker for Pf1 phage infections

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.