Recombinant Pseudomonas phage Pf3 Putative assembly protein ORF301

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Putative assembly protein ORF301; ORF301
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-301
Protein Length
full length protein
Species
Pseudomonas phage Pf3 (Bacteriophage Pf3)
Target Protein Sequence
MITLITAVPGSGKTLYAIGLIEAALSEGRPVFTNISGLVKDKFSNPHLLSDAPDDWRDTP EGSLVVYDEAQQAHLYPSNAQRGPVTDERLTAMETHRHTGHDLVFITQAPTFVHHHIRKL VGLHIHLYRSRGLQAASKYEWSHVCDSPNDRKEQQRADFVLWKFPKEHFAFYTSAVMHTH KFKMPKKIGVLLVFVVLGLGAVGFNLYKNSGLASMAEATASVAEATPSPLALNGVKPSSL AAPYQWSAAAPAVPVSGCVANRSTNRCQCFDASGVVLAIEHAACLSVISSPLPRQLLSTS K
Uniprot No.

Target Background

Function
Putative role in phage assembly.
Database Links

KEGG: vg:1260910

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is Pseudomonas phage Pf3 and its putative assembly protein ORF301?

Pseudomonas phage Pf3 belongs to the Pf bacteriophage family, which are temperate filamentous phages that infect the bacterium Pseudomonas aeruginosa. These phages can establish both lysogenic relationships (integrated into the bacterial chromosome as prophages) and chronic infection cycles. ORF301 is a 301-amino acid protein encoded by the Pf3 phage genome that functions as a putative assembly protein. Assembly proteins in filamentous phages typically participate in the morphogenesis of new virions by helping to package the single-stranded DNA genome and coordinating the assembly of structural components. Like other Pf phages, Pf3 likely has a conserved core genome structure encoding proteins necessary for DNA replication, virion assembly, and morphogenesis .

How do Pf phages contribute to Pseudomonas aeruginosa pathogenesis?

Pf phages, including Pf3, contribute significantly to P. aeruginosa pathogenesis through multiple mechanisms. They serve as structural components in the biofilm matrix, promoting bacterial adhesion to surfaces and increasing tolerance to desiccation and antimicrobials. Pf phages can dramatically increase the viscosity of cystic fibrosis (CF) airway polymers, such as mucin and DNA, potentially reducing bacterial clearance from the lung. Additionally, Pf phages have been shown to directly inhibit phagocytosis by immune cells, including dendritic cells and macrophages, further impairing bacterial clearance .

At the molecular level, Pf phages trigger anti-viral pattern recognition receptors (specifically TLR3) in immune cells, leading to production of type I interferons that antagonize antibacterial immunity. This immunomodulatory effect results in decreased expression of pro-inflammatory cytokines (including TNF) and reduced phagocytic capacity, creating conditions favorable for persistent P. aeruginosa infection .

What is known about the genomic organization of Pf bacteriophages?

Pf bacteriophages have a conserved core genome structure encoding essential functions, though specific gene arrangements may vary between strains. Using Pf4 from P. aeruginosa PAO1 as a reference model, the core genome includes genes for DNA replication (like PA0727), integration/excision (IntF and XisF4), and structural proteins (like CoaB). Regulatory elements include the c repressor (Pf4r) that maintains lysogeny by repressing the excisionase gene. The genome also includes host transcriptional regulatory sites, such as binding sites for OxyR (which responds to oxidative stress) and global histone-nucleosome-like regulators MvaT and MvaU .

Integration sites vary between different Pf phages: Pf4 in strain PAO1 integrates into the tRNA-Gly gene PA0729.1, while other Pf phages like Pf6 and Pf7 integrate into tRNA-Met genes in their respective host strains. Some P. aeruginosa strains harbor multiple distinct Pf prophages, indicating that superinfection exclusion mechanisms may be incomplete or circumventable in these phages .

What molecular mechanisms control the Pf phage lifecycle, and how might these apply to Pf3?

The Pf phage lifecycle is regulated through complex molecular mechanisms that respond to bacterial stress signals. When Pf phages maintain lysogeny, the c repressor gene (like pf4r in Pf4) suppresses the excisionase gene (xisF4), preventing phage replication. Several triggers can induce phage production: oxidative stress activates OxyR, which suppresses the c repressor; nutrient limitation sensed through proteins like DppA1 can trigger replication; and environmental conditions like semiviscous or anaerobic settings similar to biofilms and CF airways also induce phage production .

Once induced, phage replication proceeds through a rolling circle mechanism. The replication initiator protein binds to the replicative form (RF) DNA at the origin of replication, recruiting host helicase UvrD and DNA polymerase III. This produces both new copies of the dsDNA RF and ssDNA genomes. The ssDNA is initially protected by single-stranded binding proteins until packaged into new virions. Structural proteins like CoaB are processed by host Sec/YidC enzymes after insertion into the inner membrane, and then interact with morphogenesis machinery to package the ssDNA genome. The nascent phage particle is extruded through the cell envelope as assembly continues .

For Pf3 specifically, we can infer that similar mechanisms likely control its lifecycle, though specific regulatory proteins and integration sites may differ from other Pf phages.

How do the structural properties of Pf phages contribute to their functional roles in biofilms?

This ability to form liquid crystalline structures has significant implications for biofilm architecture and function. Within biofilms, these structures contribute to the viscoelastic properties of the matrix, increasing its viscosity and mechanical stability. This altered matrix protects bacteria from desiccation and antimicrobials through several mechanisms: by creating a physical barrier that limits diffusion of antimicrobials, by binding positively charged antibiotics through the phages' negative charge, and by providing structural support that maintains biofilm integrity under environmental stresses .

Additionally, Pf phages promote bacterial adhesion to surfaces and alter polymer rheology in environments like CF airways, potentially reducing bacterial clearance. The same structural attributes that drive liquid crystal assembly also promote bacterial aggregation and reduced motility, features associated with chronic infections and diminished phagocytosis by immune cells .

What role might ORF301 play in the assembly and morphogenesis of Pf3 phages based on knowledge of related proteins?

While the search results don't provide specific details about ORF301's function, we can make informed inferences based on assembly proteins in related Pf phages. In Pf4, the morphogenesis protein PA0726 and coat protein CoaB are involved in phage assembly. CoaB is particularly interesting as a model: it's translated with an N-terminal leader peptide targeting it to the inner membrane, where it's processed by host Sec/YidC enzymes into its mature form. CoaB monomers then interact with membrane-associated morphogenesis machinery to package the ssDNA genome .

If ORF301 functions similarly to these proteins, it likely participates in one or more of the following processes: (1) recognition and binding of the ssDNA phage genome, displacing single-stranded binding proteins; (2) interaction with other structural proteins to form the virion coat; (3) coordination with membrane-associated machinery to facilitate extrusion of the nascent phage through the cell envelope; or (4) maintaining the proper structure and stability of the assembled virion.

The specific molecular mechanisms of ORF301 would require experimental verification through techniques such as site-directed mutagenesis, protein-protein interaction studies, and structural analysis.

What expression systems and purification strategies are most effective for producing functional recombinant Pf3 ORF301 protein?

Based on available information, E. coli has been successfully used to express recombinant Pf3 ORF301 with an N-terminal His-tag . For optimal expression, researchers should consider the following strategies:

Expression ParameterRecommended OptionsConsiderations
E. coli strainBL21(DE3), Rosetta, Arctic ExpressChoose based on codon usage and protein solubility requirements
Expression vectorpET, pQE, pBAD seriesSelect based on desired expression level and induction system
Growth mediumLB, TB, 2xYT, minimal mediaRich media for high yield; minimal media for isotope labeling
Induction0.1-1.0 mM IPTG, 16-37°CLower temperatures often improve solubility
AdditivesGlucose, glycerol, osmolytesMay improve solubility or reduce toxicity

For purification, a multi-step approach is recommended:

  • Initial capture using Ni-NTA affinity chromatography (exploiting the His-tag)

  • Intermediate purification using ion-exchange chromatography

  • Polishing step with size-exclusion chromatography

  • Optional tag removal using appropriate protease if the tag interferes with functional studies

Buffer optimization should focus on maintaining protein stability while mimicking physiological conditions. For membrane-associated proteins like ORF301, detergents or amphipols might be necessary to maintain native conformation.

What functional assays can be designed to characterize the assembly activity of ORF301?

Several complementary approaches can be used to assess ORF301's assembly function:

Assay TypeMethodologyInformation Gained
In vitro assembly assaysReconstitution of assembly using purified componentsDirect assessment of ORF301's role in virion formation
DNA binding assaysEMSA, fluorescence anisotropy, SPRAffinity and specificity for ssDNA
Protein-protein interaction studiesCo-IP, Y2H, BLI, ITCIdentification of binding partners
Structural studiesX-ray crystallography, cryo-EM, NMRStructural basis of assembly function
MutagenesisAlanine scanning, domain deletionCritical residues and domains for function
In vivo complementationExpression in ORF301-deficient Pf3Ability to restore phage production

For in vitro assembly assays, researchers could mix purified ORF301 with Pf3 ssDNA and other necessary components, then monitor assembly using techniques like dynamic light scattering or electron microscopy. Fluorescently labeled components could be used to track the assembly process in real-time.

For in vivo studies, creating an ORF301 knockout in Pf3 and then complementing with wild-type or mutant versions would allow assessment of which domains and residues are essential for function.

How can researchers study the interactions between ORF301 and the bacterial membrane during phage assembly?

Studying ORF301's interactions with the bacterial membrane requires specialized techniques:

ApproachMethodologyInformation Gained
Membrane localizationFractionation, immunofluorescenceConfirmation of membrane association
Membrane topologyProtease protection, fluorescence quenchingOrientation and transmembrane domains
Lipid interactionsLiposome binding, monolayer insertionLipid specificity and membrane perturbation
CrosslinkingPhoto-activated or chemical crosslinkersIdentification of proximal membrane proteins
Fluorescence microscopyFRET, PALM/STORMDynamic interactions in living cells
MD simulationsIn silico modelingPredicted membrane interactions

A comprehensive approach might begin with confirming ORF301's membrane association through cell fractionation and Western blotting. Next, researchers could determine its topology using protease protection assays or reporter fusions. To identify interacting partners, crosslinking followed by mass spectrometry would be valuable. Finally, reconstitution studies using purified components and artificial membranes could reveal the mechanism of membrane interaction and phage extrusion.

For real-time visualization, fluorescently tagged ORF301 could be expressed in P. aeruginosa, and its localization and dynamics during phage induction could be monitored using super-resolution microscopy.

How should researchers interpret phenotypic differences between wild-type and ORF301-mutant Pf3 phages?

When analyzing phenotypic differences between wild-type and ORF301-mutant Pf3 phages, researchers should consider multiple levels of analysis:

Analysis LevelConsiderationsPotential Interpretations
Phage productionTiter, morphology, stabilityDirect effects on assembly
Host physiologyGrowth, stress response, gene expressionIndirect effects via host interaction
Biofilm propertiesStructure, antibiotic tolerance, viscoelasticityPopulation-level phenotypes
Infection dynamicsPersistence, spread, immune modulationIn vivo relevance

It's crucial to determine whether observed phenotypes result directly from assembly defects or from downstream effects. Complementation experiments with wild-type ORF301 should restore the wild-type phenotype if the mutation is specific. Time-course experiments can help establish cause-effect relationships, particularly for complex phenotypes like biofilm formation.

Researchers should be cautious about pleiotropic effects - mutations in assembly proteins might affect multiple processes beyond just virion formation. For instance, defects in ORF301 might alter the balance between lysogeny and lytic growth, affect the bacterial stress response, or change interactions with the host immune system .

What bioinformatic approaches can predict functional domains and interaction sites in ORF301?

Researchers can employ several bioinformatic approaches to characterize ORF301:

ApproachTools/MethodsPredictive Value
Sequence homologyBLAST, HHpred, HMMEREvolutionary relationships, conserved domains
Structural predictionAlphaFold, I-TASSER, RoseTTAFoldThree-dimensional structure
Domain predictionInterPro, PFAM, SMARTFunctional modules
Secondary structurePSIPRED, JPredHelices, sheets, disordered regions
Transmembrane domainsTMHMM, PhobiusMembrane topology
Binding site predictionConSurf, ConCavityConserved functional surfaces
Molecular dynamicsGROMACS, NAMDDynamic behavior, conformational changes

Integrating multiple approaches is essential, as is validating predictions experimentally. For instance, conservation analysis across different Pf phages can identify residues likely critical for function. These predictions can then guide site-directed mutagenesis experiments to test their roles.

Structure prediction is particularly valuable for assembly proteins, as it can reveal potential interfaces for protein-protein and protein-DNA interactions. Molecular dynamics simulations can further explore how these interfaces might change during the assembly process.

How can researchers differentiate between the direct effects of ORF301 and secondary consequences in experimental systems?

Distinguishing direct effects from secondary consequences requires careful experimental design:

StrategyMethodologyAdvantage
Temporal analysisTime-course experimentsEstablishes sequence of events
Genetic complementationExpression of wild-type in mutantConfirms specificity of phenotype
Domain-specific mutationsStructure-guided mutagenesisMaps function to specific regions
In vitro reconstitutionPurified component assaysEliminates cellular complexity
Systems biology approachMulti-omics integrationCaptures network effects
Conditional expressionInducible systemsTemporal control of expression

A powerful approach combines time-resolved experiments with conditional expression systems. By inducing ORF301 expression and monitoring immediate molecular changes (within minutes) versus longer-term phenotypic changes (hours to days), researchers can separate direct effects from downstream consequences.

For example, if ORF301 directly binds DNA, this interaction should be detectable immediately after protein expression, while effects on biofilm formation would occur much later. Similarly, direct binding partners could be identified using rapid crosslinking following induction.

When interpreting contradictory results between in vitro and in vivo experiments, researchers should consider factors like post-translational modifications, alternative interaction partners, or environmental conditions that might be present in cells but absent in purified systems .

What implications does ORF301 research have for developing anti-Pseudomonas therapeutics?

Research on ORF301 and Pf phages has significant implications for anti-Pseudomonas therapeutic development. Pf phages contribute to P. aeruginosa pathogenesis through multiple mechanisms, including biofilm formation, antibiotic tolerance, and immune modulation. Targeting Pf phage assembly through ORF301 could potentially disrupt these virulence mechanisms .

Several therapeutic strategies could emerge from this research:

  • Assembly inhibitors: Small molecules designed to specifically inhibit ORF301 function could prevent Pf phage production, potentially reducing biofilm formation and restoring antibiotic sensitivity

  • Anti-Pf vaccines: Immunization against Pf phage components could enhance bacterial clearance by preventing phage-mediated immune suppression

  • Phage-targeting antibodies: Antibodies recognizing Pf phages could neutralize their immunomodulatory effects and disrupt biofilm integrity

  • Diagnostic tools: Detection of Pf phages could help guide treatment decisions, as their presence correlates with antibiotic tolerance

In cystic fibrosis patients, where P. aeruginosa forms persistent biofilms associated with Pf phage production, these approaches could potentially improve infection management and clinical outcomes .

How do Pf phages influence the lung microbiome in chronic infections, and what role might ORF301 play?

Pf phages significantly impact the lung microbiome in chronic infections through multiple mechanisms. They modify the material properties of biofilms, making them more viscous and altering nutrient and oxygen gradients within the biofilm. Pf phages also sequester resources like iron through charge-based interactions, which can affect the growth of other microorganisms, including fungi like Aspergillus and Candida .

By contributing to biofilm architecture and stability, Pf phages create microenvironments that influence the spatial organization and metabolic interactions of the microbial community. Their immunomodulatory effects may also shape which microorganisms can persist in the lung by altering host defense mechanisms .

ORF301, as a putative assembly protein, would be essential for Pf3 phage production. Its function therefore indirectly influences all of these microbiome effects by enabling the production of phage particles. Variations in ORF301 efficiency or regulation could potentially affect the abundance of Pf3 phages in the lung, which would in turn impact biofilm properties and microbial ecology.

Studying the lung microbiome in the context of different Pf phage populations (including Pf3) could reveal how these phages shape microbial community composition and function in diseases like cystic fibrosis .

What are the most promising future research directions for understanding ORF301 function?

Several promising research directions could advance our understanding of ORF301 function:

  • Structural biology: Determining the three-dimensional structure of ORF301 through X-ray crystallography or cryo-EM would provide crucial insights into its mechanism of action

  • Host-phage interactions: Investigating how ORF301 interacts with host cell machinery during phage assembly could reveal new aspects of the Pf lifecycle

  • Comparative genomics: Analyzing ORF301 homologs across different Pf phages could identify conserved functional domains and strain-specific adaptations

  • Systems biology: Integrating proteomics, transcriptomics, and metabolomics approaches could reveal the broader impact of ORF301 function on both phage and bacterial physiology

  • Single-molecule techniques: Visualizing ORF301 during phage assembly using advanced microscopy could capture the dynamics of this process in unprecedented detail

These approaches would not only advance our fundamental understanding of phage biology but could also inform the development of novel therapeutics targeting chronic P. aeruginosa infections .

How can researchers translate insights from ORF301 studies to address clinical challenges in Pseudomonas infections?

Translating ORF301 research into clinical applications requires bridging basic science with clinical needs:

  • Biomarker development: Pf phage detection could serve as a biomarker for biofilm-associated infections and potential antibiotic tolerance

  • Precision medicine: Understanding the relationship between Pf phage presence and antibiotic response could guide personalized treatment approaches

  • Therapeutic target validation: Confirming the contribution of ORF301 to virulence in animal models and clinical isolates would strengthen its potential as a drug target

  • Combination therapies: Developing strategies that target both Pf phages and bacterial cells could overcome the limitations of current antimicrobial approaches

  • Preventive strategies: Insights into Pf phage contributions to early biofilm formation could inform preventive interventions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.