Recombinant Pseudomonas phage Pf3 Putative assembly protein ORF430

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Putative assembly protein ORF430; ORF430
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-430
Protein Length
full length protein
Species
Pseudomonas phage Pf3 (Bacteriophage Pf3)
Target Protein Sequence
SDRLTVKHHEIDIRVAIPLVADFCGRSVVLGPSIQGVVSLDFDDVPCSQAFDLLLESNHL LSSMVGDVLVITAMDQVLNSERKADDLRTFRRDLFNANDIERRVINIVHASASEVVSLFK ESFMSLDAPGMSMTVDERTNSVFAALPSSFFPALESVIQAIDVPVRQVAIEANVVEASVD WSKRLGLNWGGALSLGNWSAVTAGDLSVAAGSSIGFGFLSNTLSLDGLFTAMENEGNGRV VSRPTLLTLDRQSASVLRGTELPYQQSAGDGATSVAFKHAALSLEVKPVISPDNSIVIEV LVSRDSPNFSNAIDGVPPIDTNRLVTTIRVPHGQTVVLGGVYSTINQQGSSRVSGISRIP GIGRLFKKKEHVTEQYELLIFLTPRILGLEVEPEKQSLVFDESFFLGDLF
Uniprot No.

Target Background

Function

This protein may play a role in phage assembly.

Database Links

KEGG: vg:1260903

Subcellular Location
Host membrane; Single-pass type I membrane protein.

Q&A

What is Pseudomonas phage Pf3 Putative assembly protein ORF430?

Pseudomonas phage Pf3 Putative assembly protein ORF430 (UniProt ID: P03668) is a protein encoded by bacteriophage Pf3, which infects Pseudomonas aeruginosa. As indicated by its name, this protein is putatively involved in the assembly process of the phage particle, although its precise function remains under investigation. The full-length recombinant protein typically includes amino acids 21-430 of the native sequence and can be expressed with various tags (such as His-tag) to facilitate purification and experimental applications . The protein contains multiple functional domains that likely contribute to phage morphogenesis and structural integrity during the viral life cycle.

What expression systems are recommended for recombinant Pf3 ORF430 protein production?

E. coli expression systems are predominantly used for the production of recombinant Pf3 ORF430 protein due to their efficiency and scalability. The commercially available recombinant protein is expressed in E. coli with an N-terminal His-tag . When establishing an expression system, researchers should consider the following methodological approaches:

  • Selection of appropriate E. coli strain (BL21(DE3), Rosetta, or Arctic Express for proteins with rare codons)

  • Optimization of induction conditions (IPTG concentration, temperature, duration)

  • Vector selection based on desired fusion tags and promoter strength

For challenging expressions, alternative systems such as baculovirus-infected insect cells may be considered, though bacterial expression remains the standard for this particular protein.

What are the optimal storage and handling conditions for recombinant Pf3 ORF430 protein?

Recombinant Pf3 ORF430 protein requires specific storage conditions to maintain stability and functionality. Based on established protocols, the protein should be:

  • Stored at -20°C/-80°C upon receipt

  • Aliquoted to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity

  • Working aliquots may be stored at 4°C for up to one week

  • For long-term storage, reconstituted protein should contain 5-50% glycerol (with 50% being the standard recommendation)

The recommended reconstitution procedure involves:

  • Brief centrifugation prior to opening to bring contents to the bottom of the vial

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol to the final desired concentration

How can structural analysis techniques be applied to determine the 3D conformation of Pf3 ORF430 protein?

Determining the 3D structure of Pf3 ORF430 requires a multi-technique approach similar to that used in other structural protein studies. Researchers may consider the following methodological strategy:

  • X-ray Crystallography: This requires successful crystallization of the purified protein, which may be challenging but potentially offers high-resolution structural data.

  • Cryo-Electron Microscopy (Cryo-EM): Particularly useful for visualizing the protein in its assembled state within phage particles.

  • NMR Spectroscopy: Suitable for analyzing protein dynamics and interactions in solution.

  • Computational Modeling: As demonstrated with other viral proteins, computational approaches can generate rational 3D models based on fold prediction systems such as 3D Jury and MODELLER programs . The resulting models can be evaluated using quality assessment tools like ProQ .

  • Structure Comparison: Once a preliminary model is generated, tools such as VAST, DALI, and CE can identify structural neighbors and provide insights into potential functions .

TechniqueResolution RangeAdvantagesLimitations
X-ray Crystallography1-3 ÅAtomic-level resolutionRequires crystallization
Cryo-EM2-4 ÅCaptures native stateComplex data processing
NMR SpectroscopyVariableGood for dynamicsSize limitation (~40 kDa)
Computational ModelingN/AAccessible without experimental structureRequires validation

What methodologies are effective for studying protein-protein interactions involving ORF430?

Understanding the interactions between ORF430 and other phage or host proteins is crucial for elucidating its assembly function. Several methodological approaches are recommended:

  • Pull-down Assays: Using the His-tagged recombinant ORF430 protein as bait to identify interaction partners through affinity chromatography followed by mass spectrometry.

  • Surface Plasmon Resonance (SPR): For quantitative analysis of binding kinetics between ORF430 and putative interaction partners.

  • Biolayer Interferometry (BLI): An alternative optical technique for real-time, label-free analysis of biomolecular interactions.

  • Isothermal Titration Calorimetry (ITC): For thermodynamic characterization of binding interactions.

  • Crosslinking Mass Spectrometry (XL-MS): To capture transient interactions and identify interaction interfaces within large protein complexes.

  • Proximity Labeling: Methods such as BioID or APEX2 can identify proteins in close proximity to ORF430 in living cells.

When designing these experiments, it's important to consider the native environment of the protein and the potential effects of the His-tag on interaction properties .

What mutagenesis approaches can reveal functional domains within Pf3 ORF430?

Strategic mutagenesis can illuminate the structure-function relationships within the ORF430 protein. Researchers should consider:

  • Alanine Scanning Mutagenesis: Systematically replacing amino acids with alanine to identify residues critical for function.

  • Domain Deletion Analysis: Creating truncated versions of the protein to assess the contribution of specific regions.

  • Site-Directed Mutagenesis: Targeting conserved amino acid motifs or predicted functional sites based on sequence analysis.

  • Charged Residue Substitutions: Similar to methods used in studying the Pf3 coat protein orientation , altering charged residues can reveal electrostatic contributions to protein function and orientation.

  • Epitope Tagging at Different Positions: As demonstrated with Pf3 coat protein research, inserting epitope tags at strategic locations can help determine protein topology and accessibility .

After mutagenesis, functional assays should assess the impact on:

  • Phage assembly efficiency

  • Protein-protein interactions

  • Subcellular localization

  • Stability and folding properties

What buffer systems are optimal for maintaining ORF430 protein stability in vitro?

The choice of buffer system significantly impacts ORF430 protein stability and functionality in experimental settings. Based on recombinant protein handling recommendations, researchers should consider:

  • Standard Storage Buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been established as effective for lyophilized ORF430 protein storage .

  • Working Buffer Considerations:

    • pH range: Typically 7.0-8.0 to maintain native conformation

    • Ionic strength: 150-300 mM NaCl to prevent aggregation

    • Reducing agents: Addition of DTT or β-mercaptoethanol (0.5-1 mM) may help maintain any critical disulfide bonds

    • Protease inhibitors: To prevent degradation during longer experiments

  • Stabilizing Additives:

    • Glycerol (5-10%) to prevent aggregation in working solutions

    • Low concentrations of non-ionic detergents (0.01-0.05% Tween-20) for proteins with hydrophobic regions

When transitioning from storage to experimental conditions, gradual buffer exchange through dialysis or desalting columns is recommended to maintain protein integrity.

How should researchers design controls for ORF430 functional assays?

Robust experimental design for ORF430 functional studies requires appropriate controls to ensure valid interpretation of results:

  • Negative Controls:

    • Heat-denatured ORF430 protein to confirm activity is due to native conformation

    • Buffer-only conditions to detect background signals

    • Unrelated His-tagged protein to control for tag-specific effects

  • Positive Controls:

    • Known phage assembly proteins with established functions

    • If available, native (non-recombinant) ORF430 to compare with the His-tagged version

  • Internal Validation Controls:

    • Dose-dependent response measurements

    • Time-course experiments to capture kinetic profiles

    • Multiple detection methods to verify observations

  • System-Specific Controls:

    • For membrane interaction studies, consider controls similar to those used in Pf3 coat protein research, such as protease accessibility assays and membrane potential modulators

What techniques are recommended for studying the membrane interactions of ORF430 protein?

If ORF430 is involved in membrane interactions during phage assembly, researchers can adapt methods used successfully with Pf3 coat protein :

  • In Vivo Protease Accessibility Assays: Similar to methods used with the Pf3 coat protein, this approach can determine protein orientation and membrane topology by exposing cells to externally added proteases and analyzing the resulting fragments .

  • In Vitro Membrane Insertion Assays: Using inverted membrane vesicles to study the insertion process, as demonstrated with Pf3 coat protein .

  • Membrane Potential Dependency Studies: Assessing the role of electrochemical membrane potential in protein insertion and function, a critical factor for Pf3 coat protein orientation .

  • Epitope Tagging Strategies: Engineering specific epitope tags at strategic positions can help determine the topology of the protein in the membrane, as shown with the HIV nef protein-derived tags used in Pf3 coat protein studies .

  • Charged Residue Analysis: Examining how charged amino acids affect membrane interaction and protein orientation, following the approach that demonstrated complete orientation reversal of Pf3 coat protein upon charge alteration .

These methodologies can be adapted specifically for ORF430 to determine if and how it interacts with membranes during the phage assembly process.

How should researchers interpret structural homology between ORF430 and other proteins?

Structural homology analysis can provide valuable insights into potential functions of ORF430. Researchers should follow a systematic approach:

  • Structure Neighbor Identification: Use programs like VAST, DALI, and CE to identify structural neighbors of ORF430 .

  • Structural Alignment Quality Assessment: Evaluate the significance of structural similarity using metrics such as:

    • RMSD (Root Mean Square Deviation) of aligned residues

    • Percentage of aligned residues

    • Statistical significance scores (Z-scores from DALI or 3D Jury scores)

  • Functional Inference: When structural neighbors with known functions are identified (as was done for SARS-CoV ORF3), researchers can hypothesize potential functions for ORF430 . For instance, if ORF430 shows structural similarity to proteins involved in FAD/NAD binding, this may suggest similar biochemical activities .

  • Validation Experiments: Design experiments to test functional hypotheses derived from structural homology, such as:

    • Binding assays with predicted cofactors

    • Activity assays based on predicted enzymatic functions

    • Mutagenesis of conserved structural elements

What statistical approaches are appropriate for analyzing ORF430 interaction data?

When analyzing protein-protein interaction data involving ORF430, researchers should consider:

  • Equilibrium Binding Analysis:

    • Fit binding curves to appropriate models (one-site, two-site, cooperative binding)

    • Calculate affinity constants (Kd) and confidence intervals

    • Compare binding parameters across experimental conditions using statistical tests

  • Kinetic Data Analysis:

    • Determine association (kon) and dissociation (koff) rate constants

    • Analyze the temperature dependence to derive thermodynamic parameters

  • Network Analysis for Multi-Protein Systems:

    • Apply graph theory to map interaction networks

    • Use clustering algorithms to identify functional modules

    • Perform enrichment analysis to identify overrepresented pathways

  • Statistical Validation:

    • Use appropriate statistical tests (t-tests, ANOVA, non-parametric tests) based on data distribution

    • Implement multiple testing correction (Bonferroni, FDR) when analyzing large datasets

    • Ensure sufficient replication (typically n≥3) for robust statistical inference

How can ORF430 be utilized in synthetic biology applications?

The structural and functional properties of ORF430 may be leveraged in various synthetic biology applications:

  • Phage Engineering: Modification of ORF430 could create phages with altered host specificity or assembly properties for targeted applications in biocontrol or phage therapy.

  • Protein Scaffolds: If ORF430 participates in creating structural frameworks during phage assembly, these properties could be repurposed for designing protein-based nanostructures.

  • Membrane Protein Display Systems: Drawing parallels with studies on Pf3 coat protein , ORF430 might be engineered as a novel membrane display system for presenting heterologous proteins.

  • Biosensors: If ORF430 undergoes conformational changes upon binding to specific targets, it could potentially be engineered as a biosensing component.

When designing these applications, researchers should consider:

  • The potential impact of modifications on protein stability and function

  • The need for optimized expression systems for the engineered constructs

  • Regulatory and biosafety considerations for applications involving engineered phage components

What approaches can reveal the temporal dynamics of ORF430 during phage assembly?

Understanding when and how ORF430 functions during the phage assembly process requires techniques that can capture temporal dynamics:

  • Time-Resolved Cryo-EM: To visualize structural changes at different stages of phage assembly.

  • Pulse-Chase Experiments: To track the synthesis, processing, and incorporation of ORF430 into assembling phage particles.

  • Single-Molecule FRET: For real-time monitoring of conformational changes and interactions during assembly.

  • Time-Course Proteomics: To identify the order of protein recruitment during assembly complex formation.

  • Inducible Expression Systems: To control the timing of ORF430 expression and study its impact on assembly progression.

These approaches can help construct a comprehensive model of how ORF430 contributes to phage assembly, including its temporal relationship with other assembly components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.