Recombinant Pseudomonas phage phi6 Fusion protein P6 (P6)

Shipped with Ice Packs
In Stock

Description

Functional Role in Viral Life Cycle

P6 is indispensable during infection:

  1. Host Attachment: Mediates fusion of the phage envelope with the bacterial outer membrane after pilus retraction .

  2. Membrane Fusion: Acts as a fusogen, enabling nucleocapsid entry into the host cell .

  3. Collaboration with Lytic Enzymes: Works alongside muralytic enzyme P5 to degrade peptidoglycan layers during entry .

Research Applications

Recombinant P6 is utilized in:

  • Structural Studies: Investigating membrane fusion mechanisms and protein-lipid interactions .

  • Evolutionary Biology: Testing host-range expansion and mutational fitness in novel Pseudomonas hosts .

  • Biochemical Assays: Serving as a substrate for fluorescence spectroscopy to probe hydrophobicity changes during viral assembly .

Key Research Findings

  • Antagonistic Pleiotropy: Mutations in P6’s interacting partners (e.g., P3) often reduce fitness on native hosts, highlighting evolutionary trade-offs during host adaptation .

  • Enzyme Interactions: P6’s fusogenic activity is Mn²⁺-dependent, aligning with the broader dependency of phi6’s RNA polymerase on divalent cations .

  • Cryo-EM Insights: While high-resolution structures of P6 remain elusive, subtomogram averaging reveals its role in asymmetric envelope assembly .

Future Directions

Further studies could focus on:

  • Crystallography: Resolving P6’s atomic structure to clarify its fusogenic mechanism.

  • Host Adaptation: Engineering P6 variants to broaden therapeutic applications against antibiotic-resistant Pseudomonas strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
P6; Fusion protein P6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-168
Protein Length
Full Length of Mature Protein
Species
Pseudomonas phage phi6 (Bacteriophage phi-6)
Target Names
P6
Target Protein Sequence
SIFSSLFKVIKKVISKVVATLKKIFKKIWPLLLIVAIIYFAPYLAGFFTSAGFTGIGGIF SSIATTITPTLTSFLSTAWSGVGSLASTAWSGFQSLGMGTQLAVVSGAAALIAPEETAQL VTEIGTTVGDIAGTIIGGVAKALPGWIWIAAGGLAVWALWPSSDSKE
Uniprot No.

Target Background

Function
Mediates the fusion with the host outer membrane during virus entry into the host cell.
Database Links

KEGG: vg:956440

Subcellular Location
Virion membrane; Multi-pass membrane protein.

Q&A

What is the role of fusion protein P6 in Pseudomonas phage phi6?

Protein P6 is a critical membrane protein absolutely required for the fusion process between the phi6 viral envelope and the host bacterial outer membrane. Research has demonstrated that virus particles lacking P6 (P3-, P6- particles) completely lose their fusion capabilities, even when mixed with fusion-active particles . P6 serves as a hydrophobic membrane anchor for the P3 attachment protein, and when P3 is removed or dislocated, P6 becomes exposed which activates the fusion mechanism .

How does P6 interact with other phi6 structural proteins?

P6 primarily interacts with the P3 attachment protein, serving as its membrane anchor. This interaction is dynamic and critical for the viral infection process. When P3 is firmly bound to P6, fusion activity is decreased, as observed in BHT-resistant mutants (bht1, bht2, bht3) which showed altered P6 electrophoretic mobility and decreased fusion activity . These mutants bind P3 more firmly, demonstrating that the P3-P6 interaction must be modulated to allow P3 displacement for exposing P6 during fusion .

What is known about the structure of phi6 P6 protein?

The phi6 P6 protein is an integral membrane protein that resides in the viral envelope. Electron microscopy studies have revealed that P6 contributes to the formation of surface structures on the viral envelope when P3 is removed . While detailed atomic-level structural information remains limited, functional studies suggest that P6 undergoes conformational changes during the fusion process. The conformational relationship between P3 and P6 appears to be crucial for fusion activation .

What experimental methods are commonly used to study phi6 P6 protein function?

Several methodologies are employed to study P6 function:

  • Genetic approaches using sus mutants with mutations in gene 6 (e.g., sus277, sus453) to create P6-deficient particles

  • In vitro fusion assays that monitor the formation of multiple particles through rate zonal centrifugation

  • Electron microscopy to visualize fusion events and structural changes

  • Lipid mixing assays using fluorescently labeled lipids to monitor membrane fusion kinetics

  • BHT treatment to remove P3 while preserving P6, allowing investigation of P6-mediated fusion independently

The standard fusion assay involves centrifuging radioactively labeled virus particles together and then analyzing the formation of multiple particles by rate zonal centrifugation. Under standard conditions, approximately 25% of phi6 particles form multiple particles where two or more nucleocapsids are surrounded by a single membrane vesicle .

How can researchers express and purify recombinant P6 protein?

Though not explicitly described in the provided references, the expression and purification of hydrophobic membrane proteins like P6 typically require:

  • Expression in bacterial systems using fusion tags to enhance solubility

  • Use of membrane-mimetic environments (detergents, nanodiscs, or liposomes) during purification

  • Optimization of expression conditions to prevent aggregation

  • Functional validation through reconstitution experiments to verify fusion activity

These approaches would be necessary to obtain pure, functionally active P6 protein for detailed biochemical and structural studies.

What is the molecular mechanism of P6-mediated membrane fusion?

The fusion mechanism of phi6 appears distinct from many eukaryotic viral fusion systems. Key features include:

  • P6 is absolutely required for fusion to occur

  • Fusion activity is greatly enhanced when protein P3 is removed, suggesting P3 normally prevents premature fusion

  • The fusion process is independent of both pH and divalent cation concentration, similar to Sendai virus

  • A conformational change necessary for fusion activation appears to take place in the interaction between proteins P3 and P6

  • Fusion requires P6 in both membranes that are to fuse, suggesting possible oligomerization during fusion

Based on experimental evidence, a model emerges where P3 must be removed or dislocated to expose P6, which then activates the fusion machinery. This suggests a regulatory mechanism to ensure fusion occurs at the appropriate time during infection .

How do mutations in P6 affect membrane fusion?

Mutations in P6 can significantly impact fusion activity:

Mutation TypeEffect on FusionMechanism
BHT-resistant (bht1, bht2, bht3)Decreased fusion activity (~50% of wild-type)Altered P6 with stronger P3 binding
P6-deficient (sus277)Complete loss of fusion activityAbsence of essential fusion protein
Wild-type phi6 with P3 removedEnhanced fusion activityExposure of P6 fusion domains

These findings demonstrate that both the presence of P6 and its correct conformational state are critical for fusion activity .

What environmental factors influence P6-mediated fusion?

The following environmental factors affect P6-mediated fusion:

  • pH: Unlike many eukaryotic viral fusion proteins, phi6 fusion is independent of pH, functioning effectively at both pH 7.2 and pH 5.5

  • Divalent cations: Fusion occurs independently of divalent cation concentration, even in the presence of EDTA

  • Polyethylene glycol (PEG): Addition of 10% PEG 6000 increases fusion activity of wild-type phi6 and enables fusion of P3-, P6- particles that otherwise cannot fuse

  • Temperature: While not explicitly stated for P6, the stability of phi6 virions is temperature-dependent, with implications for fusion activity

How does P6 contribute to phi6's use as a viral surrogate in research?

Phi6 has become an important surrogate model for studying enveloped viruses:

  • Due to its lipid envelope, phi6 serves as a surrogate for pathogenic human enveloped viruses such as coronaviruses, influenza, and Ebola viruses

  • The fusion machinery, including P6, contributes to phi6's utility in studying membrane fusion mechanisms relevant to human viruses

  • Phi6 is used in persistence studies on surfaces, in water, virus inactivation research, and virus transfer experiments

What is the relationship between P6 and host specificity in cystoviruses?

Different cystoviruses show varying host specificities, which appear to be related to their fusion proteins:

  • Phi6, phiNN, and phi2954 depend on the pilus of the Pseudomonas host for infection

  • Other cystoviruses (phi8, phi12, phi13) infect non-piliated Pseudomonas strains with rough lipopolysaccharide (LPS) layers

  • Recombinant phages containing fusion components from different cystoviruses adopt the host specificity of the fusion protein donor

These observations suggest that while P3 is critical for initial host attachment, the fusion machinery including P6 plays a role in determining viable host range through compatibility with the host membrane composition .

How do the structures of fusion proteins differ among cystoviruses?

Structural studies have revealed differences in envelope surface structures among cystoviruses:

  • Phi6 has 2 nm spikes on the envelope surface formed by P3 multimeric complexes

  • Phi8 has longer 7 nm spikes

  • Phi12 displays toroidal structures on its surface

  • Phi2954 has elongated structures on its envelope surface

A recombinant phi12 phage containing the M segment from phi2954 displayed phi2954-type envelope structures and host specificity, demonstrating the relationship between surface structure and function .

What biotechnological applications utilize phi6 and its fusion machinery?

Several applications have been developed using phi6:

  • Production of high-quality dsRNA molecules for RNA interference applications to combat viral diseases

  • Use as surrogate models for studying pathogenic human enveloped viruses

  • Evaluation of virus persistence on surfaces and in environmental contexts

  • Assessment of viral inactivation strategies and transmission dynamics

The understanding of P6-mediated fusion could potentially lead to new applications in targeted delivery systems and synthetic biology approaches.

What are the limitations of using phi6 as a surrogate for human enveloped viruses?

Research has identified several limitations:

  • Phi6 shows significantly longer persistence than SARS-CoV-2 on surfaces, potentially leading to overestimation of infectiousness in persistence studies

  • Half-life differences are substantial: 81 hours for phi6 versus 1.2 hours for SARS-CoV-2 on plastic when suspended in saliva

  • The deposition solution significantly influences virus survival, with saliva providing greater protection than PBS

These findings highlight the importance of validating surrogate models through direct comparisons with the target pathogen under identical experimental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.