Recombinant Pseudomonas putida Aquaporin Z (aqpZ)

Shipped with Ice Packs
In Stock

Description

Introduction to Aquaporins

Aquaporin (AQP) is a specialized water channel protein belonging to the family of transmembrane proteins that facilitates the movement of water across cell membranes. These proteins are ubiquitous in nature, found across all domains of life from bacteria to plants and animals . The discovery and characterization of aquaporins have significantly enhanced our understanding of cellular water transport mechanisms, which are crucial for numerous biological processes.

In bacterial systems, aquaporins play essential roles in adaptation to osmotic stress, maintaining cellular volume, and surviving in varying environmental conditions. Of particular interest in biotechnology applications is Aquaporin Z (aqpZ), a bacterial water channel that exhibits remarkable specificity for water molecules while efficiently excluding ions and other solutes.

Key Molecular Properties

Table 1: Molecular Properties of Pseudomonas putida Aquaporin Z

PropertyCharacteristic
Protein Length230 amino acids
UniProt IdentifierQ88F17
Gene DesignationaqpZ
Locus NamePP_4282
Predicted Molecular Weight~24-25 kDa
Functional AssemblyTetrameric
Primary FunctionWater-specific transmembrane channel

Expression Systems

Commercially available recombinant P. putida aqpZ is typically produced in E. coli expression systems with an N-terminal 10xHis-tag to facilitate purification . This approach allows for high-yield production of the membrane protein in a form amenable to subsequent purification and functional studies.

Studies on aquaporin expression from related Pseudomonas species indicate that optimal expression conditions typically involve moderate induction temperatures (around 25°C) with extended induction periods (approximately 20 hours) . These conditions likely minimize inclusion body formation while maximizing the yield of correctly folded, functional protein.

Purification Methods

The purification of recombinant aquaporin proteins presents challenges typical of membrane proteins. The general approach involves:

  1. Cell lysis to release membrane fractions

  2. Membrane solubilization using appropriate detergents

  3. Affinity chromatography (typically using the His-tag)

  4. Size exclusion chromatography for final purification

Research on related aquaporins suggests that zwitterionic detergents, particularly [(3-cholamidopropyl) dimethylammonio]-1-propanesulfonate (CHAPS), are effective for solubilizing these membrane proteins while maintaining their native structure and function .

Functional Properties of Recombinant P. putida Aquaporin Z

The primary function of Aquaporin Z in P. putida is to facilitate the selective transport of water molecules across the cell membrane while excluding ions and other solutes . This selectivity is critical for maintaining osmotic balance and cellular homeostasis under varying environmental conditions.

Water Transport Mechanism

The water transport through aqpZ channels operates through a mechanism that does not require energy input, instead relying on osmotic gradients across the membrane. Water molecules pass through the channel in single file, with hydrogen bonding interactions guiding their movement through the pore.

The selectivity filter, comprising conserved NPA motifs and the aromatic/arginine (ar/R) constriction region, ensures that only water molecules can traverse the channel while ions (including protons/hydronium ions) are excluded. This exclusion is crucial for maintaining electrochemical gradients across the membrane.

Functional Analysis Methods

Functional analysis of recombinant aquaporins typically involves reconstitution into artificial lipid bilayers (liposomes) to form proteoliposomes that mimic the native membrane environment . These proteoliposome preparations allow for various measurements including:

  • Water permeability assays using stopped-flow light scattering

  • Particle size analysis via dynamic light scattering

  • Structural integrity assessment through circular dichroism spectroscopy

Applications of Recombinant P. putida Aquaporin Z

The unique properties of P. putida aqpZ make it valuable for various biotechnological applications.

Water Filtration Technologies

Aquaporins have been recognized for their potential in water filtration applications, offering the possibility of creating highly efficient biomimetic membranes . The high water permeability combined with exceptional selectivity makes aqpZ an attractive component for developing advanced water purification systems with reduced energy requirements compared to conventional technologies.

Comparative Analysis with Other Bacterial Aquaporins

Table 3: Comparison of Selected Bacterial Aquaporins

OrganismProteinLength (aa)Notable Features
Pseudomonas putidaAqpZ230Mesophilic water channel with biotechnology potential
Pseudomonas sp. AMS3AqpZ1Not specifiedPsychrophilic adaptation for low-temperature function
Flavobacterium johnsoniaeAqpZ79Significantly shorter sequence
Escherichia coliAqpZNot specifiedWell-characterized bacterial aquaporin model

The comparison between P. putida aqpZ and other bacterial aquaporins, particularly those from psychrophilic (cold-adapted) organisms like Pseudomonas sp. AMS3, provides valuable insights into structural adaptations that enable functionality under different environmental conditions . These comparative studies enhance our understanding of the structure-function relationships in aquaporins and guide protein engineering efforts.

Molecular Engineering

The detailed understanding of P. putida aqpZ structure and function enables targeted molecular engineering approaches to enhance or modify its properties for specific applications. Potential engineering targets include:

  • Improving water permeability rates

  • Enhancing stability under extreme conditions

  • Altering selectivity to permit controlled passage of specific solutes

  • Optimizing expression levels in heterologous systems

Current Research and Future Perspectives

Research on P. putida aqpZ continues to evolve, with emerging applications in several fields:

Biosensor Development

The selective water transport properties of aqpZ make it potentially valuable for developing biosensors that can detect changes in osmotic pressure or specific solutes that interact with the channel.

Environmental Applications

P. putida's known environmental versatility, combined with the water management capabilities conferred by aqpZ, suggests potential applications in bioremediation and environmental monitoring technologies .

Challenges and Future Directions

Despite the progress in understanding and utilizing P. putida aqpZ, several challenges remain:

  1. Optimizing large-scale production of functional recombinant protein

  2. Developing stable reconstitution systems for industrial applications

  3. Engineering variants with enhanced stability and performance

  4. Elucidating the regulatory mechanisms controlling aqpZ expression in P. putida

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
aqpZ; PP_4282; Aquaporin Z
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Target Names
Target Protein Sequence
MSLGKRMGAELIGTFWLVLGGCGSAVLAASSPLGIGVLGVAFAFGLTVLTMAFAIGHISGCHLNPAVSFGLVVGGRFPAKELLPYVIAQVIGAILAAGVIYLIASGKAGFELSAGLASNGYADHSPGGYTLGAGFVSEVVMTAMFLVVIMGATDARAPAGFAPIAIGLALTLIHLISIPVTNTSVNPARSTGPALFVGGWALQQLWLFWVAPLIGAAIGGALYRGLAKEP
Uniprot No.

Target Background

Function
Aquaporin Z (aqpZ) is a channel that facilitates osmotically driven water movement in both directions. It plays a crucial role in osmoregulation and maintaining cell turgor during volume expansion in rapidly growing cells. It mediates rapid water entry or exit in response to abrupt changes in osmolarity.
Database Links

KEGG: ppu:PP_4282

STRING: 160488.PP_4282

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Aquaporin Z (aqpZ) and what is its function in Pseudomonas putida?

Aquaporin Z is a water channel protein belonging to the major intrinsic protein (MIP) family of transmembrane proteins. In Pseudomonas putida, aqpZ facilitates the selective and rapid transport of water molecules across the cell membrane while excluding ions and other solutes. This function is critical for maintaining osmotic balance, especially under environmental stress conditions. The protein consists of 230 amino acids forming a tetrameric structure with each monomer functioning as an independent water channel . P. putida aqpZ shares structural similarities with other bacterial aquaporins but has evolved specific adaptations that enable it to function optimally in the soil environments where this bacterium naturally thrives .

How does the structure of P. putida aqpZ differ from other bacterial aquaporins?

While the complete crystal structure of P. putida aqpZ has not been extensively documented in the provided search results, comparative analyses with other bacterial aquaporins, particularly E. coli AqpZ, reveal important insights. The protein adopts the characteristic hourglass-shaped channel with six transmembrane domains and two half-helices that meet in the center of the membrane. The selectivity filter (ar/R region) in P. putida aqpZ contains conserved residues that determine its high water conductance while preventing proton leakage .

Unlike E. coli AqpZ, which has been crystalized at 2.5 Å resolution, P. putida aqpZ may possess unique structural adaptations that reflect its ecological niche and physiological requirements. These potentially include modifications in the loop regions and differences in surface-exposed residues that contribute to its stability in the P. putida membrane environment .

What expression systems are suitable for recombinant production of P. putida aqpZ?

Escherichia coli BL21(DE3) is the most commonly employed expression system for recombinant P. putida aqpZ production. This system offers several advantages, including high protein yields, established protocols, and compatibility with various affinity tags for purification. When expressing the full-length protein (amino acids 1-230), the following conditions have been found to be effective:

ParameterOptimal ConditionNotes
Expression hostE. coli BL21(DE3)Commonly used for membrane protein expression
Inducer concentration0.5 mM IPTGHigher concentrations may cause inclusion body formation
Induction temperature25°CLower temperatures reduce inclusion body formation
Induction time20 hoursExtended time increases yield of properly folded protein
Detergent for solubilizationCHAPS ([(3-cholamidopropyl) dimethylammonio]-1-propanesulfonate)Zwitterionic detergent preserves protein structure

Other expression systems such as Pseudomonas species themselves can be used for homologous expression, which may offer advantages for proper folding and post-translational modifications, though with typically lower yields than heterologous E. coli systems .

What purification methods are most effective for recombinant P. putida aqpZ?

Affinity chromatography is the method of choice for initial purification of recombinant P. putida aqpZ. When expressed with an appropriate affinity tag (such as His-tag), the protein can be effectively purified using immobilized metal affinity chromatography (IMAC). The purification workflow typically includes:

  • Cell lysis using mechanical disruption (sonication or French press)

  • Membrane fraction isolation via differential centrifugation

  • Solubilization of membrane proteins using appropriate detergents (CHAPS has shown good results)

  • IMAC purification using Ni-NTA or similar resins

  • Optional size exclusion chromatography as a polishing step to obtain tetrameric assemblies

Throughout the purification process, it is crucial to maintain the protein in the presence of detergent above its critical micelle concentration to prevent aggregation and preserve functional integrity .

How do environmental stressors affect the expression and functionality of P. putida aqpZ?

The expression and functionality of P. putida aqpZ are significantly modulated by environmental stressors, particularly metal stress. Transcriptome analysis of P. putida KT2440 under zinc stress revealed complex regulatory patterns affecting membrane proteins, including transporters and channel proteins. Under intermediate zinc stress (1.5 mmol/L), genes involved in membrane homeostasis show altered expression patterns, including upregulation of phospholipid biosynthesis genes and membrane structural proteins .

Specifically, metal stress induces changes in:

  • Membrane composition and fluidity, which can affect aqpZ folding and function

  • Protein expression levels, with differential regulation depending on stress intensity

  • Post-translational modifications that may alter water transport efficiency

  • Association with other membrane components that influence channel stability

These findings suggest that the functional characterization of recombinant P. putida aqpZ should consider the native stress responses of the organism, as these may significantly influence protein behavior in experimental settings .

What are the kinetic parameters of water transport through P. putida aqpZ and how can they be measured?

The kinetic parameters of water transport through P. putida aqpZ can be determined through several biophysical approaches. While specific kinetic values for P. putida aqpZ are not directly provided in the search results, comparative studies with other bacterial aquaporins suggest measurement approaches:

ParameterTypical Value RangeMeasurement Method
Water permeability coefficient (Pf)Expected to be several-fold higher than GlpFStopped-flow light scattering with proteoliposomes
Activation energy (Ea)Likely 3-6 kcal/mol for efficient water channelsTemperature dependence of permeability measurements
Single-channel conductanceMay approach 3-4 × 10^9 water molecules/sReconstitution in planar lipid bilayers
Selectivity ratio (water:solute)Highly selective for waterDual permeability assays with water and test solutes

For accurate measurements, reconstitution of purified P. putida aqpZ into liposomes is required. Dynamic light scattering can be used to determine particle size of liposomes and proteoliposomes, providing insights into the structural integrity of the reconstituted system .

How can heterologous expression of P. putida aqpZ be optimized for structural and functional studies?

Optimizing heterologous expression of P. putida aqpZ for structural and functional studies requires a multifaceted approach addressing several critical factors:

  • Genetic optimization: Codon optimization for the expression host and removal of rare codons can significantly improve translation efficiency. For P. putida genes expressed in E. coli, this is particularly important given the high GC content (61.5%) of the P. putida genome .

  • Expression conditions: Beyond the basic parameters described earlier, systematic optimization of media composition, especially ion concentrations and osmolarity, can dramatically improve functional protein yields.

  • Fusion partners: N-terminal fusions with soluble proteins (MBP, SUMO, etc.) can enhance folding and stability, though these must be removable without affecting the native structure .

  • Host strain engineering: Recent advances in P. putida KT2440 genome editing make it possible to modify the host to improve heterologous membrane protein expression through:

    • Deletion of competing phospholipid biosynthesis pathways

    • Upregulation of chaperones to assist proper folding

    • Engineering stress response elements to mitigate expression toxicity

What molecular mechanisms underlie the cold adaptation of aquaporins in psychrophilic Pseudomonas species?

The molecular mechanisms of cold adaptation in psychrophilic Pseudomonas aquaporins represent an important area of research with implications for both fundamental understanding and biotechnological applications. The search results highlight studies on aquaporin from psychrophilic Pseudomonas sp. AMS3, providing insights applicable to P. putida aqpZ research:

  • Amino acid composition: Cold-adapted aquaporins typically show an increased proportion of glycine residues providing conformational flexibility, reduced proline content in loops, and decreased arginine/lysine ratio for reduced hydrogen bonding, all contributing to improved function at lower temperatures.

  • Structural flexibility: Key regions including the selectivity filter and cytoplasmic loops may exhibit increased flexibility in psychrophilic variants, maintaining water conductance at temperatures where mesophilic counterparts become rigid.

  • Lipid interactions: Adaptations in transmembrane domains that interface with membrane lipids are critical, as membrane fluidity is significantly affected by temperature. These adaptations include modifications in the hydrophobic thickness and surface charge distribution of the protein.

  • Energy barriers: Reduced activation energy for water transport is a hallmark of cold-adapted aquaporins, achieved through subtle modifications of the channel architecture that lower the energetic cost of water molecule passage .

Understanding these mechanisms provides valuable insights for engineering recombinant P. putida aqpZ variants with enhanced performance in biotechnological applications at various temperature ranges.

What are the critical factors for successful reconstitution of P. putida aqpZ into artificial membranes?

Successful reconstitution of P. putida aqpZ into artificial membranes requires careful consideration of multiple factors to ensure functional and properly oriented protein incorporation:

  • Lipid composition: The choice of lipids significantly affects protein stability and activity. A mixture resembling the native P. putida membrane composition, typically including phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin in appropriate ratios, generally yields optimal results.

  • Detergent selection and removal: The zwitterionic detergent CHAPS has proven effective for P. putida aqpZ solubilization while preserving protein structure. Detergent removal must be gradual to allow proper protein insertion, commonly achieved through:

    • Dialysis (slowest but gentlest)

    • Bio-Beads addition (intermediate rate)

    • Dilution method (fastest but may reduce reconstitution efficiency)

  • Protein-to-lipid ratio: The optimal ratio typically ranges from 1:50 to 1:200 (w/w), with lower ratios favoring functional studies and higher ratios sometimes necessary for structural analyses.

  • Quality control: Dynamic light scattering should be employed to verify the size distribution of proteoliposomes, with functional validation through water permeability assays .

How can genome editing approaches improve P. putida as a chassis for recombinant aqpZ studies?

Recent advances in genome editing tools for P. putida KT2440 offer powerful approaches to enhance this organism as a chassis for recombinant aqpZ studies:

  • CRISPR-Cas9 systems: Tools like pCas9 expressing Cas9 from Streptococcus pyogenes with the RK2 origin enable precise genomic modifications in P. putida. This allows for:

    • Integration of aqpZ variants at defined chromosomal loci

    • Deletion of competing water channels or transporters

    • Modification of regulatory elements controlling expression

  • Promoter engineering: The development of libraries of characterized promoters with varying strengths allows fine-tuned expression of aqpZ, critical for proper membrane insertion and folding.

  • Pathway optimization: Carbon metabolism pathways can be modified to reduce metabolic burden during recombinant protein expression, as demonstrated in natural product biosynthesis studies using P. putida .

What analytical techniques are most informative for characterizing the structure-function relationship of P. putida aqpZ?

A comprehensive characterization of P. putida aqpZ structure-function relationships requires a combination of complementary analytical techniques:

TechniqueApplicationInformation Obtained
X-ray crystallographyHigh-resolution structural analysisAtomic-level details of protein architecture, water channel geometry, and selectivity filter
Cryo-electron microscopyStructural analysis in near-native stateVisualization of conformational states and potential flexibility regions
Molecular dynamics simulationsIn silico functional analysisWater permeation pathways, energetics, and conformational changes during transport
Stopped-flow spectroscopyKinetic measurementsWater and solute permeability coefficients under various conditions
Site-directed mutagenesisStructure-function correlationRole of specific residues in selectivity, gating, and stability
Circular dichroism spectroscopySecondary structure analysisConformational changes under different conditions (pH, temperature, etc.)
Atomic force microscopyMechanical propertiesStability and elasticity of protein in membrane environment

Integration of data from these techniques can provide a comprehensive understanding of how structural features of P. putida aqpZ determine its functional properties, particularly its high water selectivity and conductance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.