Recombinant Pseudomonas putida ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is expressed in E. coli and purified via nickel-affinity chromatography, yielding >90% purity (SDS-PAGE) . Key specifications include:

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C .

  • Reconstitution: Solubilized in deionized water with 50% glycerol for long-term stability .

  • Suppliers: Commercial sources include Creative BioMart (Cat. No. RFL30723PF, RFL5411PF) and CUSABIO (Cat. No. CSB-CF015070FFZ) .

Functional Role in P. putida Metabolism

  • Energy Conservation: Integral to oxidative phosphorylation, enabling ATP production via proton gradient dissipation .

  • Stress Adaptation: Mutations in ATP synthase genes (e.g., atpB) impair solvent tolerance by disrupting membrane potential maintenance .

  • Electrogenic Activity: Under anoxic conditions, ATP synthase activity correlates with acetate production, influencing bioelectrochemical systems .

Case Studies

  • Metabolic Engineering: Deletion of atpB in P. putida KT2440 enhanced pyruvate flux for bioproduction .

  • Solvent Tolerance: Adaptive evolution of atpB-mutant strains restored toluene tolerance via efflux pump upregulation .

  • C1 Metabolism: atpB expression is modulated during formate detoxification, linking proton motive force to C1 compound processing .

Techniques

  • ELISA: Used for quantitative detection in immunological assays .

  • CRISPR/Cas9: Targeted mutagenesis to study atpB’s role in central metabolism .

Comparative Genomic Insights

P. putida’s ATP synthase is encoded by the atpIBEFHAGDC operon. The atpB gene is conserved across strains, but isoforms may arise from strain-specific annotations (e.g., KT2440 vs. S12) . Genome-scale metabolic models (e.g., iJN1462) predict ATP synthase’s contribution to energy budgets under varying conditions .

Challenges and Future Directions

  • Functional Redundancy: Multiple aldehyde dehydrogenases (e.g., AldB-I/II) complicate atpB’s role in acetate synthesis .

  • Biotechnological Optimization: Enhancing ATP synthase efficiency could improve P. putida’s performance in bioremediation and bioproduction .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand that specific requirements may arise. If you have a preferred format, please clearly indicate it in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery times can vary based on your purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: Our standard shipping practice includes blue ice packs. If dry ice shipment is required, please communicate this need in advance. Additional fees may apply.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend a brief centrifugation of the vial to ensure the contents settle at the bottom. For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, we suggest adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers are welcome to use this as a guideline.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To minimize degradation, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize the development of the specified tag.
Synonyms
atpB; PP_5419; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Target Names
atpB
Target Protein Sequence
MAAETASGYIQHHLQNLTYGQLPDGSWGFAHSAAEAKAMGFWAFHLDTLGWSVALGLIFL LIFRMAAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLIPVDWIPQLAILISGDPHIPFRAVSTTDPNATLAMAFCVFALIIFYSIKVKGLGGFI GELTLHPFGSKNIFVQILLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEDNH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this subunit plays a crucial role in the translocation of protons across the membrane.
Database Links

KEGG: ppu:PP_5419

STRING: 160488.PP_5419

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a in Pseudomonas putida?

ATP synthase subunit a in Pseudomonas putida is a membrane-embedded component of the F₀ domain of ATP synthase. It forms part of the proton channel that facilitates proton movement across the membrane, which is essential for the rotary mechanism of ATP synthesis. The a subunit (encoded by atpB) interacts directly with the c-ring and contributes to the stability of the holocomplex V structure . This subunit plays a critical role in the energy coupling between proton translocation and ATP synthesis, making it essential for cellular energy metabolism in P. putida.

How does P. putida ATP synthase differ from mitochondrial and chloroplast ATP synthases?

While the core structure and function of ATP synthase are conserved across species, P. putida ATP synthase differs in several aspects from mitochondrial and chloroplast variants. Unlike mitochondrial ATP synthase, which includes specific mammalian subunits (such as AGP and MLQ), bacterial ATP synthases like that of P. putida typically have a simpler subunit composition . Additionally, the bacterial F-type ATP synthase in P. putida functions similarly to chloroplast ATP synthase in being reversible, capable of both ATP synthesis and hydrolysis coupled with proton translocation across the membrane . The stoichiometry of the c-ring may also differ, which affects the H⁺/ATP ratio and the bioenergetic efficiency of the enzyme.

What is the genetic organization of the ATP synthase operon in P. putida?

The ATP synthase operon in P. putida follows the typical bacterial arrangement, containing genes encoding both the F₁ and F₀ components. The atpB gene encodes subunit a of the F₀ sector. The organization typically includes other genes such as atpE (c subunit), atpF (b subunit), atpH (δ subunit), atpA (α subunit), atpG (γ subunit), atpD (β subunit), and atpC (ε subunit). This operon structure ensures coordinated expression of all ATP synthase components, which is crucial for proper assembly of the functional complex. The expression of these genes is tightly regulated in response to cellular energy demands and environmental conditions, contributing to P. putida's metabolic versatility .

What are the critical considerations for heterologous expression of P. putida ATP synthase subunit a?

Heterologous expression of P. putida ATP synthase subunit a presents several challenges that researchers must address. As a hydrophobic membrane protein, subunit a tends to aggregate and form inclusion bodies when overexpressed in systems like E. coli. Successful expression strategies include using specialized E. coli strains optimized for membrane protein expression (such as C41/C43 or Lemo21), employing fusion tags (such as maltose-binding protein or thioredoxin) to enhance solubility, and carefully optimizing induction conditions including temperature (typically lowered to 18-25°C), inducer concentration, and expression duration .

Expression vectors should contain promoters allowing fine-tuned expression control, and codon optimization may be necessary when expressing in phylogenetically distant hosts. Additionally, the presence of rare codons in the P. putida atpB sequence may necessitate the use of host strains supplying rare tRNAs. Given the integral membrane nature of subunit a, co-expression with other interacting ATP synthase subunits, particularly subunit c, may enhance stability and proper folding .

How can researchers assess the functional integrity of recombinant P. putida ATP synthase subunit a?

Assessing the functional integrity of recombinant P. putida ATP synthase subunit a requires multi-faceted approaches:

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to confirm proper secondary structure

    • Limited proteolysis to evaluate proper folding

    • Blue native PAGE to verify complex formation with other subunits

  • Functional Assays:

    • Reconstitution into liposomes and measurement of proton translocation

    • ATP synthesis/hydrolysis assays when incorporated into the complete ATP synthase complex

    • Patch-clamp techniques to measure proton conductance through reconstituted channels

  • Interaction Studies:

    • Co-immunoprecipitation with other ATP synthase subunits

    • Cross-linking studies to verify correct interaction with the c-ring

    • Surface plasmon resonance to quantify binding affinities with partner subunits

Functional assessment is particularly challenging for subunit a in isolation, as its activity is dependent on proper integration into the complete ATP synthase complex. Therefore, co-reconstitution with other essential subunits may be necessary for meaningful functional analysis.

What are the molecular determinants of proton specificity in P. putida ATP synthase subunit a?

The proton specificity of P. putida ATP synthase subunit a is determined by several key molecular features. Conserved charged residues, particularly arginine and glutamate residues in transmembrane helices, are critical for proton translocation. These residues form the proton pathway and determine the specificity for protons over other ions. Site-directed mutagenesis studies of these conserved residues can significantly impact proton translocation efficiency and ATP synthesis capabilities .

The arrangement of transmembrane helices forms a half-channel structure through which protons access the critical c-ring interface. The specific amino acid composition at this interface determines both the proton affinity and the directionality of proton movement. Additionally, the hydrophobic environment surrounding these channels ensures specificity by excluding other ions and water molecules, creating a selective pathway for protons. The specific structural differences between P. putida subunit a and homologs from other organisms may contribute to its adaptation to P. putida's unique ecological niche and metabolic requirements .

What purification strategies are most effective for recombinant P. putida ATP synthase subunit a?

Purification of recombinant P. putida ATP synthase subunit a requires specialized approaches due to its hydrophobic nature and membrane integration. The following protocol has proven effective:

Table 1: Optimized Purification Protocol for Recombinant P. putida ATP synthase subunit a

StepProcedureCritical ParametersExpected Outcome
1. Cell LysisMechanical disruption (French press or sonication)Buffer: 50 mM Tris-HCl pH 8.0, 200 mM NaCl, protease inhibitorsComplete cell disruption with minimal protein denaturation
2. Membrane IsolationUltracentrifugation (100,000 × g, 1 h)Temperature: 4°CSeparation of membrane fraction containing subunit a
3. Membrane SolubilizationDetergent treatment1-2% mild detergent (DDM, LMNG, or C12E8), 4°C, 2 hExtraction of subunit a from membranes
4. Affinity ChromatographyIMAC (for His-tagged protein)10-40 mM imidazole wash, 250-500 mM imidazole elutionCapture of target protein
5. Size ExclusionGel filtrationSuperdex 200, buffer containing 0.05% detergentSeparation of monomeric protein from aggregates

Critical considerations include maintaining detergent concentrations above CMC throughout all purification steps and performing all procedures at 4°C to minimize protein denaturation. For improved stability, incorporation of lipids (0.1-0.5 mg/mL) in purification buffers may be beneficial .

Alternative approaches include purifying the entire ATP synthase complex followed by selective dissociation and isolation of subunit a, which may yield better structural integrity. The choice between these strategies depends on the specific research objectives and downstream applications.

How can researchers reconstitute functional P. putida ATP synthase from recombinant subunits?

Reconstitution of functional P. putida ATP synthase requires a stepwise assembly approach that mimics the natural assembly process:

  • Preparation of Liposomes:

    • Use E. coli polar lipids or synthetic lipid mixtures (DOPC:DOPE:DOPG at 7:2:1)

    • Liposomes should be prepared by extrusion through polycarbonate filters (400-100 nm)

    • Internal buffer composition should support ATP synthesis (typically 5 mM succinate, 10 mM MgCl₂, 10 mM NaH₂PO₄, pH 8.0)

  • Assembly Sequence:

    • First, reconstitute the c-ring into liposomes

    • Add F₁ subcomplex (α₃β₃γδε)

    • Add peripheral stalk components

    • Finally, incorporate subunit a and A6L

This sequence follows the proposed natural assembly pathway of ATP synthase where separate modules (F₁, c-ring, and subunit a/A6L) converge at the final assembly stage . After reconstitution, functionality can be assessed by measuring ATP synthesis driven by artificially imposed proton gradients or by ATP hydrolysis coupled with proton pumping.

Success rates for functional reconstitution typically range from 20-40%, with variability depending on protein quality and reconstitution conditions. Optimization of protein-to-lipid ratios (typically 1:50 to 1:200 w/w) is critical for achieving functional reconstitution.

What genetic engineering approaches can enhance recombinant production of P. putida ATP synthase subunits?

Several genetic engineering strategies can significantly improve the recombinant production of P. putida ATP synthase subunits:

  • Codon Optimization:

    • Adjusting codon usage to match the host organism can increase expression by 2-5 fold

    • Focus particularly on rare codons at the N-terminus, which can impact translation initiation

  • Fusion Tags and Expression Enhancers:

    • N-terminal fusions with MBP or SUMO can increase solubility

    • Addition of signal sequences directing membrane insertion can improve proper localization

    • Incorporation of stabilizing mutations identified through directed evolution

  • Expression System Selection:

    • For laboratory-scale production: E. coli with tunable expression systems

    • For larger-scale production: P. putida itself as an expression host, leveraging its native folding machinery

  • Genomic Integration Strategies:

    • Integration of expression cassettes into P. putida chromosome for stable expression

    • Use of transposon-based systems for efficient integration

    • Application of CRISPR-Cas9 for precise genomic editing

When using P. putida as the expression host, researchers should consider employing genome-reduced strains like P. putida EM42, which shows improved heterologous expression capabilities due to reduced metabolic burden and improved genetic stability .

How does the oligomeric state of ATP synthase affect P. putida energy metabolism?

The oligomeric state of ATP synthase significantly impacts P. putida's energy metabolism through several mechanisms. ATP synthase in bacteria, including P. putida, can exist as monomers and dimers, with the dimerization primarily occurring through interactions in the F₀ domain where subunit a plays a critical role . This oligomerization affects:

  • Proton Translocation Efficiency:

    • Dimeric ATP synthase may have coordinated rotational mechanics, potentially improving efficiency of proton utilization

    • The specific arrangement of dimers can create localized proton microenvironments that enhance proton capture

  • Membrane Organization:

    • ATP synthase dimers contribute to membrane curvature, potentially creating specialized membrane domains

    • This organization may facilitate interaction with other respiratory chain components, improving electron transport chain efficiency

  • Metabolic Adaptation:

    • The ratio of monomeric to oligomeric ATP synthase can shift in response to different growth conditions

    • This dynamic organization allows P. putida to fine-tune its energy metabolism in response to environmental changes, contributing to its metabolic versatility and robustness in various environments

These structural arrangements are particularly relevant for P. putida's ability to adapt to fluctuating nutrient availability and its remarkable metabolic flexibility, which makes it a valuable organism for biotechnological applications .

What role does ATP synthase subunit a play in P. putida's adaptation to different environmental conditions?

ATP synthase subunit a plays a crucial role in P. putida's adaptation to diverse environmental conditions through several mechanisms:

  • pH Adaptation:

    • The proton channel formed by subunit a contains specific residues that may be optimized for P. putida's preferred pH range

    • This specialization allows efficient ATP synthesis across varying soil pH conditions

  • Temperature Response:

    • The thermal stability of subunit a contributes to P. putida's ability to maintain energy metabolism across temperature fluctuations

    • Specific amino acid compositions may enhance flexibility or rigidity at different temperatures

  • Energy Efficiency Tuning:

    • The specific structure of subunit a affects the H⁺/ATP ratio, allowing P. putida to optimize energy conservation under nutrient-limited conditions

    • This efficiency is critical for survival in competitive soil environments

  • Metabolic Switching:

    • ATP synthase regulation, including subunit a function, is integrated with P. putida's sophisticated metabolic control systems

    • This integration enables rapid switching between different carbon sources and metabolic modes, a hallmark of P. putida's versatility

The specific adaptations in P. putida ATP synthase subunit a likely contribute to this organism's remarkable ability to thrive in diverse and challenging environments, including contaminated soils where its bioremediation capabilities are valuable.

How can mutations in ATP synthase subunit a impact P. putida's biotechnological applications?

Mutations in ATP synthase subunit a can significantly impact P. putida's biotechnological applications through several mechanisms:

  • Energy Efficiency Modulation:

    • Strategic mutations can alter the H⁺/ATP ratio, potentially increasing energy efficiency for bioproduction

    • Higher efficiency mutants may improve yields in bioproduction by reducing ATP consumption for maintenance

  • Stress Tolerance Enhancement:

    • Mutations stabilizing subunit a can improve P. putida performance under industrial conditions

    • Enhanced stability can extend bioreactor operational lifetimes and improve process economics

  • Anaerobic Functionality:

    • Engineering subunit a to function more efficiently under microaerobic conditions could expand P. putida's application range

    • This is particularly relevant for electro-fermentation applications where P. putida operates under anaerobic conditions with an electrode as electron acceptor

  • Metabolic Engineering Integration:

    • Coordinated engineering of ATP synthase with other metabolic pathways can optimize energy allocation

    • This systemic approach can direct energy toward product formation rather than biomass production

Table 2: Potential Biotechnological Impacts of ATP Synthase Subunit a Modifications

Modification TypePotential EffectBiotechnological ApplicationExpected Outcome
Proton pathway alterationsChanged H⁺/ATP ratioBioproduction of high-energy compoundsImproved yield coefficients
Stability enhancementsIncreased temperature toleranceIndustrial bioremediationExtended operational range
Interface modificationsAltered dimerization propertiesMembrane protein production platformsEnhanced membrane protein yields
Regulatory site engineeringModified response to cellular energy statusDynamic bioprocess controlResponsive production systems

These modifications highlight the potential for ATP synthase engineering to contribute to P. putida's further development as a platform organism for industrial biotechnology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.