Recombinant Pseudomonas putida Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us; we will prioritize developing the specified tag.
Synonyms
clsA; cls; PP_5364; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-481
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Target Names
clsA
Target Protein Sequence
MHMDYHSPYFFGYLLGLIHLLGIVAALHALFTVRTAQGAIAWAMPLLFIPYLTLIPYLIF GARSFYAYIKARRQANQEMHVAMANLNWRPWVEEALTARESESYTALRAMPKLGRMPCLA NNQVKLLINGKATFDAIFAAIEKARDVVLVQFFIIHDDTLGKALQQLLLRKAAEGVQVFV LYDRVGSHALPSSYSQVLRDGGVQIHAFATRRGWFNRFQVNFRNHRKIVVVDGLLGFIGG HNVGDEYLGEHPQLSPWRDTHVQISGPVLACLQESFAEDWYWATRQLPPLILPDTYPDNG VLCQALASGPADPQETCSLFFLEAIHSATRRVWITSPYFIPDEAVFAALRLAVLRGVDVR VLIPSRPDHRIVYAASSLFAFEAVRAGVRMFRYQPGFLHQKVVLVDDDVSAIGSANLDNR SFRLNFEITLLTVDRGFADQVEHMLQEDFEQAREITAEDTQDTHRLQQLGMRIARLISPI L
Uniprot No.

Target Background

Function
This recombinant *Pseudomonas putida* cardiolipin synthase (Cls) catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, yielding cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links

KEGG: ppu:PP_5364

STRING: 160488.PP_5364

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase (cls) in Pseudomonas putida?

Cardiolipin synthase (cls) in Pseudomonas putida is an enzyme responsible for the synthesis of cardiolipin, a key phospholipid component in bacterial membranes. The enzyme catalyzes the condensation of two phosphatidylglycerol molecules to form cardiolipin, contributing to membrane integrity, fluidity, and function. In P. putida, cls plays a crucial role in the homeoviscous adaptation process, which allows bacteria to modify their membrane composition in response to chemical stimuli . The full-length protein consists of 479 amino acids, with the protein sequence available for research applications . Functionally, cls belongs to the enzyme classification 2.7.8.- and is encoded by the cls gene, which is designated as PputW619_5143 in some P. putida strains .

How does cardiolipin content affect membrane properties in P. putida?

Cardiolipin content significantly influences membrane properties in P. putida, particularly regarding membrane fluidity and permeability. Research with cls mutants has demonstrated that reduced cardiolipin levels lead to increased membrane rigidity, as measured by fluorescence polarization using DPH probes that intercalate into membranes . This altered rigidity affects membrane permeability and the function of membrane-embedded proteins, particularly efflux pumps involved in antibiotic and solvent resistance . The specific molecular structure of cardiolipin, with its four acyl chains and two phosphate groups, creates unique biophysical properties in bacterial membranes that contribute to proper membrane function. When cardiolipin levels are reduced, as in cls knockout mutants, the membrane becomes more rigid, compromising its ability to respond to environmental stresses .

What phenotypic changes occur in P. putida cls knockout mutants?

P. putida cls knockout mutants exhibit several distinct phenotypic changes compared to wild-type strains. These include: (1) significantly smaller cell size, despite showing no major growth rate defects; (2) increased sensitivity to toluene shocks, highlighting the role of cardiolipin in solvent tolerance; (3) enhanced susceptibility to various antibiotics, suggesting compromised membrane barrier function or drug efflux mechanisms; (4) increased membrane rigidity as measured by fluorescence polarization; and (5) compromised function of RND efflux pumps, evidenced by higher accumulation rates of ethidium bromide inside mutant cells . These phenotypic changes collectively demonstrate the importance of cardiolipin in maintaining proper membrane function and cellular stress responses, particularly in a bacterium like P. putida that is known for its remarkable solvent tolerance capabilities .

What is the relationship between cardiolipin content and sensitivity to membrane-active compounds?

The relationship between cardiolipin content and sensitivity to membrane-active compounds in P. putida is significant and multifaceted. Research has shown that cls mutants with reduced cardiolipin levels exhibit increased sensitivity to various membrane-active compounds, including antibiotics and cationic surfactants . This enhanced sensitivity likely results from altered membrane properties, particularly increased rigidity and permeability . The presence of adequate cardiolipin in the membrane appears to provide protection against these compounds through several mechanisms: maintaining appropriate membrane fluidity, supporting proper efflux pump function, and potentially creating a charge-based barrier against cationic compounds . Additionally, the function of RND efflux pumps, which are critical for extruding toxic compounds, is compromised in cls mutants, leading to increased accumulation of these substances inside the cells .

How is cardiolipin involved in bacterial homeoviscous adaptation?

Cardiolipin plays a significant role in bacterial homeoviscous adaptation, which is the process by which bacteria modify their membrane composition in response to environmental stressors to maintain optimal membrane fluidity and function. In P. putida, cardiolipin contributes to this adaptation process by altering the physical properties of the membrane . When P. putida is exposed to stressors like organic solvents or antibiotics, the cardiolipin content in the membrane can be modulated to adjust membrane rigidity and permeability . Homeoviscous adaptation in bacteria also involves other mechanisms such as changes in the ratio of saturated/unsaturated fatty acids, cis/trans fatty acid isomerization, and cyclopropanation, but cardiolipin synthesis represents a critical aspect of phospholipid head group modification during adaptive responses . The absence of proper cardiolipin synthesis, as observed in cls mutants, results in more rigid membranes that are less capable of adapting to environmental challenges .

How do mutations in the P. putida cls gene affect efflux pump activity and antimicrobial resistance?

Mutations in the P. putida cls gene significantly impact efflux pump activity and antimicrobial resistance through multiple mechanisms. Research has shown that cls mutants accumulate ethidium bromide (a substrate for RND efflux pumps) at higher rates than wild-type strains, indicating compromised efflux pump function . This dysfunction may occur through two primary mechanisms: First, the altered membrane composition and increased rigidity in cls mutants may disrupt the proper folding, insertion, or conformational dynamics of efflux pump proteins within the membrane . Second, many efflux pumps require a proton motive force for activity, and cardiolipin is known to interact with proteins involved in establishing membrane potential; thus, reduced cardiolipin could alter the energetics required for pump function . The compromised functioning of these efflux systems in cls mutants leads to increased sensitivity to multiple antibiotics, demonstrating the critical link between cardiolipin synthesis and antimicrobial resistance mechanisms in P. putida .

What molecular mechanisms link cardiolipin structure to membrane rigidity in P. putida?

The molecular mechanisms linking cardiolipin structure to membrane rigidity in P. putida involve several biophysical and biochemical properties of this unique phospholipid. Cardiolipin possesses a distinctive structure with four acyl chains and two phosphate groups, creating a conical molecular geometry that induces negative curvature in membranes and forms specialized domains . In P. putida, fluorescence polarization studies using DPH probes have revealed that cls mutants with reduced cardiolipin content exhibit increased membrane rigidity . This effect can be explained by several mechanisms: (1) Cardiolipin's conical shape creates packing defects in the membrane that allow for increased lateral mobility of phospholipids, enhancing fluidity; (2) Cardiolipin-rich domains serve as platforms for membrane protein assembly and function; (3) The double phosphate head group of cardiolipin can form hydrogen bonds with membrane proteins, influencing their conformation and activity; and (4) Cardiolipin interacts with divalent cations, which can bridge adjacent phospholipids and affect membrane properties .

How can cls expression be optimized for heterologous protein production in P. putida?

Optimizing cls expression for heterologous protein production in P. putida requires strategic approaches to ensure proper membrane composition while supporting recombinant protein synthesis. Several key strategies can be implemented: (1) Selection of appropriate integration sites or "landing pads" for cls genes - research has identified genomic regions in P. putida with consistent expression patterns under diverse conditions, which could provide stable cls expression ; (2) Use of insulated expression cassettes with strong terminators to prevent unwanted genomic read-through from affecting cls expression ; (3) Careful promoter selection - condition-independent promoters would maintain consistent cls expression levels regardless of environmental conditions ; (4) Implementation of codon optimization for improved translation efficiency in P. putida; and (5) Consideration of the genomic context's influence on gene expression, as "hot" and "cold" spots exist in the P. putida genome that can dramatically affect expression levels . Additionally, modulating cls expression levels could be used to fine-tune membrane properties to better support the functional expression of heterologous membrane proteins .

What role does cardiolipin play in P. putida's remarkable solvent tolerance?

Cardiolipin plays a crucial role in P. putida's remarkable solvent tolerance through multiple mechanisms affecting membrane structure and function. Research with cls knockout mutants has demonstrated increased sensitivity to toluene shocks compared to wild-type strains, directly linking cardiolipin content to solvent resistance . This enhanced tolerance likely stems from cardiolipin's unique structural properties: (1) Its conical shape and ability to form specialized membrane domains help maintain appropriate membrane fluidity and elasticity when challenged with organic solvents; (2) Cardiolipin supports the proper functioning of RND efflux pumps that actively export toxic solvents from the cell, as evidenced by compromised efflux function in cls mutants ; (3) Cardiolipin-rich domains may help segregate and localize solvent molecules, preventing them from disrupting critical cellular processes; and (4) The ability to modulate cardiolipin content represents a key aspect of P. putida's homeoviscous adaptation mechanism when exposed to solvents . Understanding these cardiolipin-dependent mechanisms could inform strategies for engineering enhanced solvent tolerance in P. putida strains used for bioremediation or biocatalysis applications involving toxic organic compounds.

How can recombinant cls genes be used to engineer stress-resistant P. putida strains?

Engineering stress-resistant P. putida strains through recombinant cls genes offers promising avenues for enhanced biotechnological applications. This approach could involve several strategies: (1) Overexpression of native or heterologous cls genes to increase cardiolipin content, potentially enhancing tolerance to solvents, antibiotics, and other stressors ; (2) Introduction of cls variants from extremophile bacteria that produce cardiolipins with specialized fatty acid compositions suited for particular stress conditions; (3) Fine-tuning cls expression using characterized genomic integration sites ("landing pads") that provide consistent expression under various conditions ; (4) Implementation of stress-responsive promoters to dynamically regulate cardiolipin synthesis based on environmental conditions; and (5) Combinatorial approaches targeting multiple membrane adaptation mechanisms simultaneously, such as coupling cls overexpression with modifications to fatty acid synthesis pathways. When implementing these strategies, careful characterization of membrane properties, growth characteristics, and stress tolerance is essential to confirm the desired phenotypic improvements. Additionally, the genomic context of integrated cls genes significantly impacts expression levels, making the selection of appropriate integration sites critical for successful strain engineering .

What are the optimal methods for quantifying cardiolipin content in P. putida membranes?

Quantifying cardiolipin content in P. putida membranes requires careful selection and implementation of analytical methods. For comprehensive analysis, a multi-technique approach is recommended: (1) Thin-layer chromatography (TLC) provides a relatively simple method for separating and visualizing phospholipids, including cardiolipin, from total lipid extracts; (2) High-performance liquid chromatography (HPLC) coupled with evaporative light scattering detection (ELSD) offers more precise quantification; (3) For the highest sensitivity and resolution, liquid chromatography-mass spectrometry (LC-MS/MS) enables identification and quantification of specific cardiolipin species with different fatty acid compositions . When implementing these methods, careful attention to lipid extraction procedures is crucial - typically, the Bligh and Dyer method or Folch extraction is used, followed by appropriate fractionation steps. For fluorescence-based visualization of cardiolipin distribution within cells, the cardiolipin-specific dye 10-N-nonyl acridine orange (NAO) can be used in conjunction with fluorescence microscopy . For comparative studies between wild-type and recombinant strains, standardized growth conditions and harvesting points are essential, as cardiolipin content varies with growth phase and environmental conditions.

How can genomic integration of cls be optimized in P. putida?

Optimizing genomic integration of cls genes in P. putida requires strategic approaches to ensure stable expression and appropriate functional outcomes. Recent advances in P. putida genetic tools offer several effective methods: (1) Selection of appropriate integration sites or "landing pads" - research has identified genomic regions with consistent expression patterns under diverse conditions, which could provide stable cls expression ; (2) Implementation of Cas9-assisted homologous recombination, which has been successfully used for large DNA constructs in P. putida, allowing precise genomic integration ; (3) Use of integrative vectors containing homology arms for the targeted region, with medium-copy origins like p15A improving cloning efficiency for large constructs ; (4) Addition of functional origin of transfer (oriT) to enable efficient conjugation, which is more effective than electroporation for introducing large plasmids into P. putida ; (5) Implementation of strong terminators to prevent genomic read-through from flanking promoters that might interfere with cls expression . When designing integration constructs, it's important to recognize that genomic "hot" and "cold" spots exist in P. putida, causing strong promoter-independent variations in gene expression . Therefore, characterization of different integration sites for their impact on cls expression is valuable for optimizing recombinant cls performance.

What analytical techniques are best for characterizing recombinant P. putida Cardiolipin synthase activity?

Characterizing recombinant P. putida Cardiolipin synthase activity requires specialized analytical techniques that address both the enzyme's catalytic function and its effects on membrane properties. For direct enzyme activity assessment: (1) Radiometric assays using 14C or 32P-labeled phosphatidylglycerol as substrate, followed by thin-layer chromatography separation and quantification of labeled cardiolipin product; (2) HPLC or LC-MS based assays measuring the conversion of phosphatidylglycerol to cardiolipin in reconstituted systems; (3) Coupled enzyme assays monitoring the release of glycerol during the condensation reaction. For assessing the functional impact of recombinant cls activity: (1) Membrane fluidity analysis using fluorescence polarization with DPH probes to determine if recombinant cls expression restores wild-type membrane fluidity levels ; (2) Cardiolipin quantification and distribution analysis using NAO staining and fluorescence microscopy; (3) Stress resistance phenotyping, particularly testing sensitivity to toluene and antibiotics, which are significantly affected by cardiolipin content ; (4) Efflux pump activity assays using substrates like ethidium bromide to assess if recombinant cls expression restores normal efflux function . When implementing these methods, appropriate controls are essential, including comparison to wild-type strains, cls-knockout mutants, and complemented mutant strains expressing the recombinant cls gene.

Comparative Analysis of Wild-type and cls Mutant P. putida Phenotypes

Phenotypic CharacteristicWild-type P. putidacls Mutant P. putidaImplications
Cell SizeNormalSignificantly smallerCardiolipin influences cell morphology
Growth RateNormalNo significant defectCardiolipin not essential for basic growth
Membrane Cardiolipin ContentNormal levelsReduced levelsConfirms cls gene function
Membrane Rigidity (DPH fluorescence)Lower (more fluid)Higher (more rigid)Cardiolipin contributes to membrane fluidity
Toluene Shock ToleranceResistantMore sensitiveCardiolipin critical for solvent stress adaptation
Antibiotic SensitivityMore resistantMore sensitiveCardiolipin affects drug resistance mechanisms
Ethidium Bromide AccumulationLower rateHigher rateIndicates compromised efflux pump function
Cationic Surfactant SensitivityLowerHigherCardiolipin affects response to membrane-active compounds

This comparative analysis reveals the multifaceted role of cardiolipin in P. putida physiology, particularly in maintaining appropriate membrane properties and supporting stress response mechanisms. The data demonstrates that while cardiolipin is not essential for viability under standard conditions, it becomes critical when cells face environmental challenges such as solvent exposure or antibiotic treatment .

Molecular Characteristics of P. putida Cardiolipin synthase

CharacteristicDescription
Gene Namecls
Locus TagPputW619_5143 (in P. putida strain W619)
Protein Length479 amino acids
Molecular Weight~54 kDa (estimated)
Catalytic ActivityCondensation of two phosphatidylglycerol molecules to form cardiolipin
EC Number2.7.8.-
Cellular LocalizationMembrane-associated
Storage BufferTris-based buffer, 50% glycerol
Storage ConditionsStore at -20°C; for extended storage, -20°C or -80°C
Amino Acid SequenceMDYHSPYFFGYVLGLVHLLGIIAALHAVFTVRTAQGAIAWAMSLFFIPYFTLIPYLVFGARSFNAYIKARRQANQEMHVAMANLNWRPWVEEALTARESQSYAALRAMPKLGRMPCLANNQVKLLIDGRATFDAIFAAIEQAREVVLVQFFIIHNDTIGKALQQLLLRKAADGVKVFVLYDRVGSHALPASYSQSLRDAGVQIHAFATRRGWFNRFQVNFRNHRKIVVVDGVTGFIGGHNVGDEYLGGNPHLSPWRDTHVQIGGPVLACLQESFAEDWYWATRQLPPLILPDAYPDNGVLCQALASGPADPQETCSLFFIEAIHSATRRVWITSPYFIPDEAVFAALRLAVLRGVDVRILIPARPDHRIVYAASSLFAFEAVRAGVRMFRYQPGFLHQKVVLVDDEVSAIGSANLDNRSFRLN FEITLLTVDRDFADQVETMLTTDFEQAREITPEDSSKRIQQLGMRIARLISPIL

Understanding these molecular characteristics is essential for designing effective expression systems, purification strategies, and functional studies of recombinant P. putida Cardiolipin synthase. The detailed information about protein structure, storage conditions, and sequence provides the foundation for experimental work with this enzyme .

Genomic Integration Strategies for Recombinant cls Genes in P. putida

Integration ApproachKey FeaturesAdvantagesConsiderations
Characterized genomic landing padsIntegration sites with consistent expression patternsCondition-independent expression; predictable performance Requires characterization of site-specific expression levels
Insulated expression cassettesStrong terminators to prevent genomic read-throughMinimizes interference from surrounding genomic elements Additional sequence requirements increase construct size
Cas9-assisted homologous recombinationPrecise genome editing using CRISPR-Cas9 systemAllows integration of large DNA constructs with high specificity Requires design of specific sgRNAs and repair templates
Conjugation-based transferUse of oriT-containing vectorsMore efficient than electroporation for large constructs Requires donor strain for conjugation
Medium-copy originsp15A origin instead of high-copy ColE1Improves stability of large constructs during cloning Lower copy number may affect plasmid yield

The selection of appropriate integration strategies significantly impacts the stability and expression levels of recombinant cls genes in P. putida. Recent advances in genetic tools for this organism have expanded the options available for precise genomic integration, allowing researchers to optimize cls expression for various applications .

Methods for Analyzing Cardiolipin Function in P. putida

MethodApplicationKey ParametersExpected Outcomes
Thin-layer Chromatography (TLC)Qualitative analysis of membrane phospholipidsSolvent system optimization for cardiolipin separationVisual confirmation of cardiolipin presence/absence
LC-MS/MSQuantitative analysis of cardiolipin speciesIonization parameters, chromatographic separationPrecise quantification of different cardiolipin molecular species
Fluorescence Microscopy with NAOVisualization of cardiolipin distributionNAO concentration (100-500 nM)Identification of cardiolipin-rich domains in cells
Fluorescence Polarization (DPH probe)Membrane fluidity assessmentDPH concentration, temperature controlMeasurement of membrane rigidity changes
Antibiotic Susceptibility TestingFunctional impact of cardiolipin alterationsMIC determination for multiple antibiotic classesCorrelation between cardiolipin content and drug resistance
Solvent Tolerance AssaysStress response evaluationToluene concentration, exposure timeAssessment of membrane integrity under solvent stress
Efflux Pump Activity AssaysMembrane protein function assessmentEthidium bromide concentrationQuantification of transport activity changes

This methodological toolkit enables comprehensive characterization of cardiolipin's role in P. putida, from basic biochemical analyses to functional studies of membrane properties and stress responses. The combination of these approaches provides a multifaceted view of how cardiolipin influences bacterial physiology and adaptation mechanisms .

Impact of Cardiolipin on Heterologous Expression Systems in P. putida

AspectInfluence of CardiolipinResearch Implications
Membrane Protein ExpressionSupports proper folding and insertion of membrane proteinsMay improve expression of challenging membrane proteins
Cellular Stress ResponseHelps manage stress from heterologous protein productionCould enhance tolerance to metabolic burden
Secretion System FunctionMaintains appropriate membrane properties for secretion machineryMay improve yields of secreted recombinant proteins
Solvent ToleranceEnhances resistance to solvents used in biotransformation processesSupports applications involving toxic substrates or products
Antibiotic SelectionAffects sensitivity to antibiotics used for selectionMay influence choice of selection markers
Cell Size and MorphologyImpacts cellular dimensions and potentially production capacityCould affect volumetric productivity in bioprocesses

Understanding these relationships enables strategic optimization of P. putida as a heterologous expression host. Modulating cardiolipin content through recombinant cls expression could be a valuable approach for enhancing the production of challenging proteins, particularly those associated with membranes or requiring efficient secretion systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.