Recombinant Pseudomonas putida Cytochrome o ubiquinol oxidase protein CyoD (cyoD)

Shipped with Ice Packs
In Stock

Description

Introduction to CyoD and Its Biological Role

CyoD is a critical subunit of the cytochrome o ubiquinol oxidase complex in Pseudomonas putida, a Gram-negative bacterium renowned for its environmental adaptability and metabolic versatility. This enzyme serves as a terminal oxidase in the aerobic respiratory chain, facilitating electron transfer to oxygen and maintaining cellular redox balance .

PropertyValueSource
Gene Locus TagPP_0815
RefSeq IDNP_742976.1
Molecular Weight12.3 kDa
Isoelectric Point (pI)8.22
Subcellular LocalizationInner membrane
Transmembrane Domains3 predicted regions

CyoD is part of the cyoABCDE operon, encoding subunits II, I, III, IV, and the heme o synthase, respectively . Its conservation across P. putida strains highlights its essential role in aerobic respiration and stress adaptation .

Functional Roles in Stress Response and Metabolism

CyoD is integral to P. putida's survival under abiotic stress:

  1. Acid Stress Adaptation: The cyo operon is indispensable for maintaining intracellular pH and redox balance during acid exposure .

  2. Catabolic Repression: Cytochrome o oxidase activity influences metabolic regulation, linking electron transport to pathways like alkane degradation .

  3. Heavy Metal Tolerance: While not directly linked to CyoD, P. putida’s stress proteome includes efflux pumps and redox regulators that interact with respiratory processes .

Regulatory Mechanisms and Expression Patterns

CyoD expression is modulated by environmental cues:

ConditionExpression LevelRegulatory MechanismSource
High-quality carbon (glutamate)Catabolite repression (Crc protein)
Poor-quality carbon (glycerol)Nutrient limitation signaling
Acidic pHAlkaline stress response

The cyo operon is inversely regulated to the cyd operon (cytochrome d oxidase), ensuring respiratory flexibility under oxygen-limited conditions .

Research Applications and Biotechnological Relevance

Recombinant CyoD is employed in:

  • Structural Studies: Elucidating membrane protein folding and redox coupling .

  • Metabolic Engineering: Optimizing P. putida strains for biofuel production or bioremediation .

  • Biosensor Development: Monitoring environmental stressors via redox-state changes .

Comparative Genomics and Evolutionary Insights

CyoD orthologs are conserved across Pseudomonas species, though regulatory networks vary:

StrainCyoD PresenceStress AdaptationSource
KT2440 (soil isolate)YesAcid, organic pollutants, heavy metals
W619 (endophyte)YesPlant-microbe interactions, nutrient scarcity
F1 (aromatic degrader)YesHydrocarbon contamination

Phylogenetic analysis reveals divergence in alr (alanine racemase) and dadX genes, suggesting niche-specific adaptations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
cyoD; Cytochrome bo(3 ubiquinol oxidase subunit 4; Cytochrome o ubiquinol oxidase subunit 4; Cytochrome o subunit 4; Oxidase bo(3 subunit 4; Ubiquinol oxidase polypeptide IV; Ubiquinol oxidase subunit 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Pseudomonas putida (Arthrobacter siderocapsulatus)
Target Names
cyoD
Target Protein Sequence
MANAHDTHHEGNHGSVKSYMIGFILSIILTAIPFGLAMSPSLPKNLTVLIIVAMAVIQVV VHLVYFLHMDRSKEQRNNVWTFLFTTLVIALLVGLSLWIMFSIHFEMLAK
Uniprot No.

Target Background

Function
Cytochrome bo(3) ubiquinol terminal oxidase is the dominant component of the aerobic respiratory chain in *E. coli* when cells are grown under high aeration conditions. In addition to electron transfer, it exhibits proton pump activity across the membrane, pumping 2 protons per electron.
Protein Families
Cytochrome c oxidase bacterial subunit 4 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of CyoD in the cytochrome o ubiquinol oxidase complex of P. putida?

CyoD is one of the essential subunits of the cytochrome o ubiquinol oxidase complex in the aerobic respiratory chain of Pseudomonas putida. Similar to its homolog in E. coli, the cytochrome o complex in P. putida functions as a terminal oxidase that catalyzes the transfer of electrons from ubiquinol to oxygen, generating water while simultaneously contributing to the proton motive force across the membrane .

While the E. coli cytochrome o oxidase consists of at least four subunits (encoded by cyoABCDE), CyoD specifically plays a crucial role in the assembly and stability of the entire complex . Although smaller than the main catalytic subunits (CyoB and CyoA), CyoD is integral to the proper folding and membrane integration of the complex.

What expression systems are most suitable for recombinant production of P. putida CyoD?

For recombinant expression of P. putida CyoD, several systems can be employed depending on the research objectives:

The optimal expression temperature is typically lower than the standard growth temperature (25-30°C instead of 37°C) to allow proper folding of this membrane protein. Additionally, induction conditions should be carefully optimized to prevent formation of inclusion bodies .

How can I verify successful expression and membrane integration of recombinant CyoD?

Verification of successful CyoD expression and proper membrane integration requires multiple complementary approaches:

  • Western blot analysis: Using polyclonal or monoclonal antibodies against CyoD or against an epitope tag (if the recombinant protein contains one). Membrane fractions should be carefully isolated through ultracentrifugation protocols specific for membrane proteins .

  • Functional assays: Measurement of ubiquinol oxidase activity in isolated membrane fractions using spectrophotometric methods to detect ubiquinol oxidation rates.

  • Membrane protein extraction verification: Differential extraction with increasing detergent concentrations can confirm proper membrane integration versus aggregation in inclusion bodies.

  • Spectrometric analysis: Similar to the approach used for CyoB in E. coli, reduced-minus-oxidized spectra can identify characteristic absorption peaks associated with proper heme incorporation in the complex .

  • Fluorescence microscopy: If CyoD is fused with fluorescent protein tags, membrane localization can be visualized directly.

Proper controls should include samples from non-induced cultures and from strains expressing known membrane proteins with similar characteristics .

What are the optimal genetic engineering strategies for enhancing CyoD expression in P. putida?

Advanced genetic engineering approaches to optimize CyoD expression in P. putida require sophisticated strategies tailored to this non-model organism:

  • Codon optimization: While P. putida has a naturally high GC content (61-63%) , codon optimization of the cyoD gene according to P. putida's codon usage bias can significantly enhance expression levels.

  • Promoter selection and engineering: The use of native P. putida promoters or synthetic promoters designed specifically for this host can improve transcription efficiency. The following promoter systems have shown success:

    Promoter TypeStrengthRegulationRecommended Application
    Pm/XylSHighInducible (m-toluic acid)High-level, controlled expression
    PtrcHighIPTG-inducibleLaboratory-scale studies
    PEM7MediumConstitutiveContinuous expression
    Pnative (cyoD)Low/NaturalNative regulationPhysiological studies
  • Genomic integration: Using CRISPR/Cas9 technology or the I-SceI-based system for P. putida allows stable genomic integration of cyoD expression cassettes, avoiding plasmid instability issues . Recent innovations in P. putida genomic engineering include:

    • RecET-based markerless recombineering for deletion and integration of large gene clusters

    • Thermoinducible single-stranded recombineering systems

    • CRISPR interference (CRISPRi) for fine-tuned gene regulation

  • Co-expression of chaperones: Specific chaperones that assist in membrane protein folding can be co-expressed to enhance proper CyoD integration into the membrane.

  • Streamlined chassis strains: Using reduced-genome P. putida strains like SEM10 can improve heterologous protein production by eliminating competing pathways and reducing metabolic burden .

How does the membrane environment affect the stability and function of recombinant CyoD in P. putida?

The membrane environment critically influences both stability and function of recombinant CyoD in P. putida. This aspect requires careful consideration at multiple levels:

  • Membrane composition effects: P. putida naturally adapts its membrane composition in response to environmental stresses, including changes in:

    • Fatty acid saturation levels

    • cis-trans isomerization of membrane phospholipids

    • Phospholipid head group composition

    These adaptations directly impact membrane protein insertion, stability, and activity. Researchers can manipulate membrane properties by:

    • Controlling cultivation temperature (lower temperatures increase unsaturated fatty acids)

    • Supplementing specific fatty acids to the growth medium

    • Co-expressing enzymes involved in phospholipid biosynthesis

  • Effects of solvent tolerance mechanisms: P. putida's natural solvent tolerance mechanisms, including efflux pumps and membrane modification systems, may influence CyoD stability. These mechanisms can be advantageous when expressing membrane proteins that are otherwise toxic to the host cell .

  • Protein-lipid interactions: Specific lipid requirements for CyoD function should be investigated through:

    • Lipid substitution experiments

    • Reconstitution in defined liposome systems

    • Site-directed mutagenesis of putative lipid-interacting residues

  • Respiratory chain assembly: Complete functionality requires proper assembly with other subunits (CyoA, CyoB, CyoC) in the membrane. Stoichiometric expression of all components may be necessary for optimal complex formation and stability .

What analytical techniques are most effective for structural characterization of recombinant CyoD?

Structural characterization of membrane proteins like CyoD requires specialized techniques:

  • Cryo-electron microscopy (Cryo-EM): Currently the most powerful approach for membrane protein structural studies, allowing visualization of the protein in a near-native lipid environment. Sample preparation typically involves:

    • Detergent solubilization optimization (testing multiple detergents like DDM, LMNG, etc.)

    • Formation of protein-lipid nanodiscs or reconstitution in lipid nanodiscs

    • Vitrification conditions optimization

  • X-ray crystallography: Though challenging for membrane proteins, this approach has been successful for respiratory complexes. Critical steps include:

    • Extensive detergent screening

    • Lipid cubic phase crystallization

    • Co-crystallization with antibody fragments to increase polar surface area

  • Nuclear Magnetic Resonance (NMR): For specific domains or the entire CyoD (which is relatively small compared to other subunits):

    • Solution NMR for soluble domains

    • Solid-state NMR for the membrane-embedded protein

    • Selective isotopic labeling strategies to focus on specific regions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information about protein dynamics and solvent-accessible regions without requiring crystallization.

  • Cross-linking mass spectrometry: Reveals spatial relationships between CyoD and other subunits of the complex through chemical or photo-crosslinking followed by mass spectrometric analysis.

What are the most effective methods for studying the interaction between CyoD and other subunits of the cytochrome o oxidase complex?

Studying the interactions between CyoD and other cytochrome o oxidase subunits requires multiple complementary approaches:

  • Co-purification studies: Expression of tagged versions of different subunits allows assessment of complex formation through pull-down assays. Based on findings from E. coli studies, CyoD likely associates closely with CyoB and CyoC subunits .

  • FRET-based interaction assays: By tagging different subunits with appropriate fluorophore pairs, Förster Resonance Energy Transfer can detect proximity and interaction in vivo.

  • Bacterial two-hybrid screening: Modified for membrane proteins, this approach can detect binary interactions between CyoD and other components.

  • Site-directed mutagenesis: Systematic mutation of conserved residues in CyoD can identify critical interaction interfaces with other subunits.

  • Chemical cross-linking coupled with mass spectrometry: This approach can map interaction sites between subunits with amino acid-level resolution by:

    • Using bifunctional cross-linkers of various lengths

    • Performing partial proteolysis of the cross-linked complex

    • Analyzing cross-linked peptides by tandem mass spectrometry

  • Complementation studies: Expression of wild-type or mutant CyoD variants in a cyoD-deficient strain can assess functional rescue and identify critical regions for complex assembly.

Why is my recombinant CyoD showing low expression levels in P. putida?

Low expression levels of recombinant CyoD in P. putida can result from multiple factors that require systematic troubleshooting:

  • Transcriptional issues:

    • Promoter strength may be insufficient - consider switching to stronger promoters like Ptrc or Pm/XylS system

    • Verify mRNA levels using RT-qPCR to determine if the issue is at the transcriptional level

    • Check for unexpected regulation of the chosen promoter under your specific growth conditions

  • Translational efficiency:

    • Optimize the ribosome binding site (RBS) strength using predictive algorithms specific for P. putida

    • Consider the GC-rich nature (61-63%) of P. putida when designing expression constructs

    • Evaluate codon usage and optimize if necessary, particularly for rare codons

  • Protein stability issues:

    • Membrane proteins are often subject to rapid degradation when not properly integrated

    • Co-express appropriate chaperones to assist with membrane insertion

    • Include protease inhibitors during extraction and analysis

    • Consider fusion tags that may enhance stability

  • Growth conditions and induction parameters:

    • Optimize growth temperature (often lower temperatures improve membrane protein expression)

    • Test different induction timing and inducer concentrations

    • Consider slower induction protocols (e.g., auto-induction media or lower inducer concentrations)

    • Evaluate different media compositions that may affect membrane composition

  • Technical extraction issues:

    • Ensure proper membrane fraction isolation

    • Optimize detergent types and concentrations for membrane protein extraction

    • Verify extraction efficiency with control membrane proteins

How can I distinguish between apo-CyoD and properly assembled CyoD within the cytochrome o complex?

Distinguishing between isolated apo-CyoD and properly assembled CyoD within the complete cytochrome o complex requires specialized biochemical and biophysical approaches:

  • Blue Native PAGE analysis: This non-denaturing electrophoresis technique preserves protein complexes and can separate the fully assembled cytochrome o complex from individual subunits. Western blotting with anti-CyoD antibodies following BN-PAGE can identify the fraction of CyoD incorporated into larger complexes.

  • Size exclusion chromatography: When combined with multi-angle light scattering (SEC-MALS), this approach can determine the molecular weight of protein complexes containing CyoD, distinguishing between the monomeric subunit and assembled complex.

  • Spectroscopic analysis: The fully assembled cytochrome o complex has characteristic absorption spectra due to its heme components. While CyoD itself may not contain heme, its association with heme-containing subunits (like CyoB) can be detected through difference spectra and CO-binding studies, similar to techniques used for E. coli cytochrome o characterization .

  • Activity assays: Only properly assembled complexes will show ubiquinol oxidase activity, which can be measured using:

    • Oxygen consumption assays with membrane preparations

    • Spectrophotometric monitoring of ubiquinol oxidation

    • Artificial electron donors with specific reaction with the intact complex

  • Protease susceptibility patterns: Isolated CyoD typically shows different protease digestion patterns compared to the protected CyoD integrated within the complex.

What strategies can overcome inclusion body formation when expressing recombinant CyoD?

Inclusion body formation is a common challenge when expressing membrane proteins like CyoD. Several strategies can help overcome this issue:

  • Optimization of expression conditions:

    • Reduce expression temperature to 16-25°C

    • Use weaker promoters or lower inducer concentrations

    • Implement pulse-expression protocols with short induction periods

    • Consider auto-induction media for gradual protein expression

  • Genetic modifications to the expression construct:

    • Include fusion partners known to enhance solubility (e.g., MBP, SUMO)

    • Add signal sequences to improve membrane targeting

    • Engineer a larger periplasmic domain if applicable

    • Remove or modify hydrophobic regions that may trigger aggregation

  • Co-expression strategies:

    • Co-express chaperones specific for membrane protein folding

    • Co-express other subunits of the cytochrome o complex to promote correct assembly

    • Implement the complete cyoABCDE operon for stoichiometric production of all subunits

  • Membrane engineering approaches:

    • Leverage P. putida's natural ability to modify its membrane composition under stress

    • Supplement specific lipids that may facilitate membrane protein insertion

    • Exploit the robust stress response mechanisms of P. putida for improved protein folding

  • Recovery strategies if inclusion bodies still form:

    • Develop refolding protocols specific for CyoD using mild detergents

    • Implement step-wise refolding in artificial membrane systems

    • Use high-throughput screening of refolding conditions with different detergents and lipids

How can I optimize recombinant CyoD expression under simulated microgravity conditions?

Recent research has shown that simulated microgravity (SMG) can enhance recombinant protein production in E. coli . This approach can be adapted for P. putida CyoD expression:

  • SMG cultivation system setup:

    • Utilize high-aspect rotating-wall vessels (HARV) with horizontal rotation to achieve SMG

    • Maintain appropriate rotation speed (typically 25-40 rpm) to balance between mixing and minimizing shear stress

    • Compare with normal gravity controls (vertical rotation of the same vessel)

  • Physiological adaptations under SMG:

    • Monitor transcriptomic and proteomic changes in P. putida under SMG

    • Focus on upregulation of protein synthesis machinery, protein folding modulators, and protein export systems observed in similar systems

    • Adjust induction timing based on the altered growth kinetics under SMG

  • Expression optimization under SMG:

    • Test different promoter systems, as transcriptional responses may differ under SMG

    • Optimize inducer concentrations specific to SMG conditions

    • Monitor plasmid copy number, which may be elevated under SMG as observed in E. coli

  • Integrated protocols:

    • Implement fed-batch strategies adapted for HARV systems

    • Develop specific extraction protocols for membrane proteins from cells cultivated under SMG

    • Consider the altered membrane composition that may result from SMG cultivation

SMG cultivation has shown promising results for enhancing recombinant protein production, with observed increases in both protein yield and plasmid copy number . The unique stress responses triggered under these conditions may be particularly beneficial for membrane proteins like CyoD that are challenging to express.

What are the most accurate methods for measuring the enzymatic activity of the cytochrome o complex containing recombinant CyoD?

Accurate measurement of cytochrome o complex activity requires specialized techniques that assess the ubiquinol oxidase function while accounting for the presence of recombinant CyoD:

  • Oxygen consumption measurements:

    • Clark-type oxygen electrodes can directly measure O₂ consumption rates

    • High-resolution respirometry allows detection of small changes in consumption rates

    • Activity should be measured with specific substrates (ubiquinol analogs) and inhibitors to distinguish from other terminal oxidases

  • Spectrophotometric assays:

    • Monitor ubiquinol oxidation at 275-290 nm

    • Measure cytochrome reduction/oxidation states through difference spectra

    • Perform CO-binding studies to verify functional heme components

  • Membrane potential measurements:

    • Evaluate proton pumping activity using pH-sensitive fluorescent dyes

    • Measure membrane potential generation using voltage-sensitive probes

    • Reconstitute the purified complex in liposomes for controlled proton gradient measurements

  • Electron transfer kinetics:

    • Stopped-flow spectroscopy can assess rapid electron transfer reactions

    • Flash photolysis techniques allow time-resolved measurements of electron transfer

    • Temperature dependence studies can reveal thermodynamic parameters of the reaction

  • Inhibitor profiling:

    • Establish inhibition profiles using known cytochrome o inhibitors

    • Compare IC₅₀ values between wild-type and recombinant complexes

    • Use site-directed mutagenesis of key residues to correlate structure with inhibitor sensitivity

How can systems biology approaches enhance our understanding of recombinant CyoD expression and function in P. putida?

Systems biology offers powerful tools to comprehensively understand recombinant CyoD expression and function within the broader metabolic context of P. putida:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to build a comprehensive picture

    • Identify regulatory networks affecting cyoD expression

    • Map metabolic shifts that occur during recombinant expression

  • Genome-scale metabolic modeling:

    • Utilize existing P. putida genome-scale models to predict optimal expression conditions

    • Perform flux balance analysis to identify metabolic bottlenecks affecting energy metabolism

    • Simulate the impact of different oxygen uptake rates on cytochrome o expression and function

  • Regulatory network analysis:

    • Map transcription factors and regulatory elements controlling native cyoD expression

    • Identify global regulators responding to recombinant protein production stress

    • Develop predictive models for expression optimization

  • Comparative systems analysis:

    • Compare expression patterns between P. putida and other hosts like E. coli

    • Analyze differences in respiratory chain regulation across conditions

    • Identify unique P. putida adaptations that could benefit recombinant expression

  • Integration with synthetic biology:

    • Design synthetic regulatory circuits to optimize expression

    • Implement dynamic regulation strategies responding to cellular metabolic state

    • Develop minimal cell factories with streamlined genomes focused on recombinant production

The systems biology approach is particularly valuable for membrane proteins like CyoD that are integrated into complex cellular processes. P. putida's robust metabolism and stress resistance mechanisms can be better leveraged through comprehensive systems-level understanding .

What emerging technologies show promise for enhancing recombinant CyoD production in P. putida?

Several cutting-edge technologies show significant promise for improving recombinant CyoD production in P. putida:

  • CRISPR-based genome engineering:

    • CRISPR interference (CRISPRi) for fine-tuned regulation of competing pathways

    • Precise genome editing for optimized integration of expression cassettes

    • Multiplexed genetic modifications to create specialized chassis strains

  • Synthetic biology tools specifically designed for P. putida:

    • Expanded SEVA platform vectors with new features for membrane protein expression

    • Synthetic promoters with tunable strength and regulation properties

    • Novel ribosome binding sites optimized for membrane protein translation

  • Nanobiotechnology approaches:

    • Nanopore-based single-molecule techniques for studying membrane insertion

    • Biomimetic membrane systems for improved membrane protein folding

    • Microfluidic cultivation systems with precise environmental control

  • Artificial intelligence for strain design:

    • Machine learning algorithms for predicting optimal expression conditions

    • Automated laboratory systems for high-throughput optimization

    • In silico protein engineering to enhance CyoD stability and expression

  • Advanced bioreactor designs:

    • Specialized membrane-aerated bioreactors that optimize oxygen delivery while minimizing shear stress

    • Perfusion systems that enable precise control of growth conditions

    • Rotating wall vessel systems that implement simulated microgravity conditions

These emerging technologies can be combined in an integrated workflow to systematically address the challenges of membrane protein expression and create next-generation production systems for CyoD and similar proteins.

How might the study of recombinant CyoD contribute to our understanding of bacterial respiratory systems?

The study of recombinant CyoD offers unique opportunities to advance our understanding of bacterial respiratory systems in several key areas:

  • Evolutionary conservation and divergence:

    • Comparative analysis of CyoD structure and function across bacterial species

    • Identification of conserved residues essential for assembly versus species-specific adaptations

    • Understanding of how respiratory complexes evolved in different bacterial lineages

  • Regulatory integration:

    • Elucidation of how terminal oxidases are regulated in response to environmental conditions

    • Understanding of cross-talk between different terminal oxidases

    • Mapping of signaling pathways that control respiratory chain composition

  • Structural insights:

    • Determination of the precise role of CyoD in complex assembly and stability

    • Identification of interaction surfaces between different subunits

    • Understanding of how electron transfer is coordinated between complex components

  • Biotechnological applications:

    • Development of bacterial strains with optimized respiratory systems for industrial applications

    • Engineering of P. putida strains with enhanced oxygen utilization capabilities

    • Creation of biosensors based on respiratory chain components

  • Disease relevance:

    • Understanding of similar complexes in pathogenic bacteria

    • Identification of potential targets for new antimicrobial compounds

    • Development of inhibitors specific to bacterial respiratory systems

The versatile metabolism of P. putida makes it an excellent model for studying respiratory adaptations to different environments, potentially revealing fundamental principles of respiratory chain function and regulation that extend beyond this specific organism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.