Recombinant Pseudomonas putida Disulfide bond formation protein B 2 (dsbB2)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Pseudomonas putida Disulfide bond formation protein B 2 (dsbB2) is a bacterial oxidoreductase engineered for heterologous expression, primarily in E. coli. It belongs to the Dsb (disulfide bond) system, which facilitates the formation of disulfide bonds in nascent or misfolded proteins, ensuring proper folding and functional stability .

Key identifiers

  • UniProt ID: P59344

  • Gene name: dsbB2

  • Synonyms: PP_0190, Disulfide oxidoreductase 2

  • Protein length: Full-length (1–168 amino acids) .

Primary Sequence and Molecular Architecture

The dsbB2 protein sequence (MLPARLRTFFLPACLVALAVLVASFRLENTVGLMPCPLCLSQRLLLGGYALLCFAAVLQA PGTRGILRYARLALGCSLAGALLAARHVWLQGAEGVNEVCPVPIGRVFEQSWSEAARQLL LGGPDCRSLAWSFLDLTLPEWSLLAFLLLAVLPLSCLLAYRFRTLART) includes a catalytic domain responsible for disulfide bond formation .

PropertyValueSource
N-terminal tagHis-tag
Protein length168 amino acids
Molecular weight (estimated)~18.5 kDa (without tag)
Purity>90% (SDS-PAGE)

Expression Hosts and Post-Translational Modifications

dsbB2 is expressed in diverse hosts to optimize yield and functionality:

Host SystemAdvantagesApplications
E. coliHigh yield, rapid productionRecombinant protein studies
YeastLimited post-translational modificationsStructural studies
Baculovirus (insect)Complex glycosylation (not required)Functional assays (if needed)
Mammalian cellsAdvanced PTMs (e.g., phosphorylation)Rarely used for dsbB2

Note: E. coli and yeast are preferred for dsbB2 due to cost-effectiveness and shorter turnaround times .

Functional Role and Research Applications

dsbB2 catalyzes the oxidation of cysteine residues in target proteins, enabling disulfide bond formation. While its endogenous role in P. putida remains underexplored, recombinant dsbB2 is leveraged in biotechnological contexts:

Enabling Recombinant Protein Production

  • Heterologous expression: dsbB2 supports the folding of disulfide-bond-dependent proteins in engineered P. putida strains, enhancing their utility as biosynthetic platforms for natural products (e.g., rhamnolipids, terpenoids) .

  • Stress tolerance: P. putida’s robust stress response systems, including efflux pumps and chaperones, synergize with dsbB2 to maintain protein stability under harsh conditions .

Biotechnological Utility

Production Protocol

  1. Expression: dsbB2 is typically expressed in E. coli under inducible promoters (e.g., T7).

  2. Purification: His-tagged dsbB2 is purified via nickel affinity chromatography, yielding >90% purity .

  3. Conjugation: Avi-tag biotinylated variants enable specific detection and immobilization .

Handling Recommendations

ParameterGuidelineRationale
Storage-20°C/-80°C (aliquoted)Prevent degradation
ReconstitutionDeionized water (0.1–1.0 mg/mL)Maintain solubility
Freeze-thaw cyclesMinimize to ≤3 cyclesAvoid protein aggregation

Buffer: Lyophilized dsbB2 is reconstituted in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .

Challenges and Future Directions

  • Stability limitations: Repeated freeze-thaw cycles compromise activity, necessitating aliquoting for long-term storage .

  • Host compatibility: Yeast and mammalian systems may introduce unintended modifications, though dsbB2’s function is largely independent of eukaryotic PTMs .

  • Research gaps: Direct studies on dsbB2’s catalytic mechanism or substrate specificity in P. putida are lacking, limiting its targeted application in synthetic biology.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your requests as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag type, please inform us, and we will prioritize developing it.
Synonyms
dsbB2; PP_0190; Disulfide bond formation protein B 2; Disulfide oxidoreductase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Target Names
dsbB2
Target Protein Sequence
MLPARLRTFFLPACLVALAVLVASFRLENTVGLMPCPLCLSQRLLLGGYALLCFAAVLQA PGTRGILRYARLALGCSLAGALLAARHVWLQGAEGVNEVCPVPIGRVFEQSWSEAARQLL LGGPDCRSLAWSFLDLTLPEWSLLAFLLLAVLPLSCLLAYRFRTLART
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: ppu:PP_0190

STRING: 160488.PP_0190

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional relationship between dsbB2 and dsbA in Pseudomonas putida?

Disulfide bond formation in Pseudomonas putida involves a coordinated system where DsbA functions as the primary oxidoreductase that directly catalyzes disulfide bond formation in substrate proteins, while DsbB2 serves as the membrane protein that reoxidizes DsbA to maintain the catalytic cycle. The deletion of dsbA in P. putida results in enhanced extracellular matrix production consisting of both capsular polysaccharides and exopolysaccharides, which promotes biofilm formation . This suggests that DsbB2, as part of this pathway, likely plays a crucial role in maintaining normal extracellular matrix production by ensuring proper DsbA function. The disruption of this relationship may lead to similar phenotypic changes observed in dsbA mutants, including altered stress responses and biofilm characteristics.

How does environmental pH affect the function of disulfide bond formation proteins in Pseudomonas putida?

P. putida strains with mutations in disulfide bond formation proteins, specifically dsbA mutants, display differential sensitivity to pH conditions. These mutants show increased sensitivity to alkaline stress (pH 9.0-10.0) compared to wild-type strains . Interestingly, acidic conditions (pH 5.0) do not affect the mutants' survival but stimulate polysaccharide production and pellicle formation . This suggests that disulfide bond formation proteins like DsbB2 may be critical for maintaining protein stability and function under alkaline conditions. When designing experiments involving DsbB2, researchers should carefully control environmental pH, as it may significantly impact protein activity, stability, and physiological outcomes.

What experimental approaches are most effective for analyzing dsbB2 expression in Pseudomonas putida?

For analyzing dsbB2 expression in P. putida, a multi-faceted approach combining molecular and biochemical techniques is recommended:

  • Quantitative PCR (qPCR): For measuring transcript levels under various conditions

  • Western blotting: For protein quantification using specific antibodies

  • Reporter gene fusions: Construction of dsbB2-lacZ or dsbB2-gfp fusions to monitor expression in real-time

  • RNA-Seq: For genome-wide expression analysis to understand dsbB2 in context of other genes

When designing these experiments, it's crucial to include appropriate controls, such as housekeeping genes for qPCR normalization, and to test expression under various environmental conditions including different pH levels, as dsbA mutants show differential responses to acidic and alkaline conditions .

What are the optimal methods for purifying recombinant Pseudomonas putida DsbB2 while maintaining protein activity?

Purification of membrane proteins like DsbB2 requires specialized approaches:

Purification StepMethodCritical ParametersTypical Yield
Expression SystemE. coli BL21(DE3) with pET vectorInduction: 0.5 mM IPTG, 20°C overnight3-5 mg/L culture
Membrane ExtractionDetergent solubilization1-2% n-dodecyl-β-D-maltoside (DDM), 4°C70-80% recovery
PurificationNi-NTA affinity chromatography20 mM imidazole (wash), 250 mM imidazole (elution)85-90% purity
Size ExclusionSuperdex 200Flow rate: 0.5 ml/min in 0.05% DDM buffer>95% purity
Activity PreservationInclusion of lipids0.02-0.05% E. coli lipid extractMaintains >80% activity

When optimizing this protocol, consider that the presence of disulfide bonds in DsbB2 itself makes the protein susceptible to oxidative damage. Therefore, inclusion of reducing agents like 1-5 mM DTT during initial extraction, followed by controlled oxidation during later purification steps, may improve yields of properly folded protein. All buffers should be degassed and purification should be performed under nitrogen atmosphere when possible.

How can researchers effectively design genetic knockout and complementation systems for studying dsbB2 function?

For comprehensive functional analysis of dsbB2 in P. putida, employ these genetic approaches:

  • Knockout Construction:

    • CRISPR-Cas9 system: Target specific dsbB2 sequences with minimal off-target effects

    • Homologous recombination: Replace dsbB2 with antibiotic resistance cassette flanked by 500-1000 bp homology regions

    • Suicide vector strategy: Use non-replicating plasmids carrying the knockout construct

  • Complementation System Design:

    • Inducible expression vectors: Use vectors with tightly regulated promoters (Ptac or PBAD)

    • Single-copy chromosomal integration: Employ mini-Tn7 transposon systems for stable expression

    • Native promoter constructs: Include 500 bp upstream of dsbB2 to maintain native regulation

  • Verification Methods:

    • Phenotypic analysis: Compare biofilm formation, polysaccharide production, and pH sensitivity

    • qRT-PCR: Confirm absence of dsbB2 transcript in knockouts and restored expression in complemented strains

    • Protein detection: Western blot analysis with specific antibodies

Based on observations from dsbA mutants, researchers should examine knockout phenotypes under both acidic and alkaline conditions, as different stress responses may be observed . Additionally, monitor extracellular matrix production and biofilm formation, as these are significantly affected in disulfide bond formation protein mutants.

What sophisticated analytical techniques can reveal the interaction network of DsbB2 in the Pseudomonas putida cellular context?

To elucidate the comprehensive interaction network of DsbB2:

  • Crosslinking Mass Spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers like DSS or DSP

    • Perform in vivo crosslinking followed by affinity purification

    • Identify interaction sites via LC-MS/MS analysis

  • Proximity-based Labeling:

    • Construct DsbB2-BioID or DsbB2-APEX2 fusion proteins

    • Allow biotinylation of proximal proteins in living cells

    • Purify biotinylated proteins and identify via mass spectrometry

  • Bacterial Two-Hybrid Analysis:

    • Create fusion constructs with split adenylate cyclase domains

    • Screen against genomic DNA library to identify novel interactors

    • Validate using co-immunoprecipitation or pull-down assays

  • Super-resolution Microscopy:

    • Tag DsbB2 with photoactivatable fluorescent proteins

    • Visualize subcellular localization and co-localization with other proteins

    • Perform time-lapse imaging to capture dynamic interactions

When implementing these techniques, researchers should carefully consider the membrane localization of DsbB2 and adjust protocols accordingly. Based on dsbA mutant studies, focus particularly on proteins involved in extracellular matrix production, stress response pathways, and biofilm formation, as these systems are significantly affected by disruption of disulfide bond formation proteins .

How does the presence or absence of functional DsbB2 affect Pseudomonas putida colonization of plant roots?

Based on research with dsbA mutants, the disulfide bond formation system plays a critical role in plant-microbe interactions. P. putida strains with enhanced biofilm formation capability, such as dsbA mutants, demonstrate increased efficiency in attaching to certain plant seeds, particularly tomato and pepper, resulting in longer germinated roots . This enhanced attachment leads to improved root colonization and plant growth promotion .

For researching DsbB2's role in this process:

  • Establish root colonization assays comparing wild-type and dsbB2 mutant strains using:

    • Fluorescently-labeled bacterial strains for microscopic visualization

    • Serial dilution plating of root homogenates for quantitative assessment

    • Confocal microscopy for spatial distribution analysis

  • Monitor plant growth parameters including:

    • Root length and architecture

    • Shoot biomass and development

    • Stress resistance indicators

  • Analyze plant-specific responses by testing multiple plant species, as the attachment phenotype varies between plant species (effective in tomato and pepper but not cucumber) .

The differential response across plant species suggests that each plant seed has unique surface properties or exudates that interact differently with bacterial attachment systems influenced by the disulfide bond formation pathway.

What methodologies can determine the mechanisms by which DsbB2 influences stress adaptation in the plant rhizosphere?

To investigate DsbB2's role in stress adaptation within the plant rhizosphere:

  • Rhizosphere Simulation Systems:

    • Develop microfluidic devices that mimic rhizosphere gradients

    • Create soil microcosms with controlled chemical composition

    • Establish plant-bacterial co-culture systems with real-time monitoring

  • Multi-omics Approaches:

    • Transcriptomics: RNA-Seq of bacteria under various rhizosphere conditions

    • Proteomics: Quantitative proteomics focusing on membrane and secreted proteins

    • Metabolomics: Profile metabolite exchange between plants and bacteria

  • Stress Response Assays:

    • pH challenge tests: Compare survival and gene expression at pH 5.0-10.0

    • Oxidative stress: Measure response to hydrogen peroxide and superoxide

    • Competitive fitness: Co-inoculate wild-type and mutant strains to assess relative fitness

  • Biochemical Analysis:

    • Measure activities of key stress response enzymes (catalases, peroxidases)

    • Quantify extracellular matrix components under different stress conditions

    • Analyze redox balance within bacterial cells during plant interaction

When designing these experiments, consider that dsbA mutants show differential sensitivity to pH, with particular vulnerability to alkaline conditions but enhanced polysaccharide production under acidic stress . Rhizosphere pH varies significantly depending on plant species, soil type, and root exudates, making it an important variable to control in these studies.

What structural features distinguish Pseudomonas putida DsbB2 from canonical DsbB proteins in other bacterial species?

P. putida DsbB2 possesses several distinctive structural features compared to canonical DsbB proteins:

  • Transmembrane Domain Organization:

    • Four transmembrane segments arranged in a unique configuration

    • Larger periplasmic loops connecting transmembrane helices

    • Modified quinone-binding pocket with altered spatial arrangement

  • Catalytic Cysteine Residues:

    • Conserved CXXC motifs with species-specific residue preferences

    • Altered positioning of redox-active cysteines affecting electron transfer kinetics

    • Unique disulfide connectivity patterns during catalytic cycle

  • Quinone Interaction:

    • Specialized binding pocket accommodating specific quinone types

    • Modified quinone reduction mechanism optimized for Pseudomonas metabolism

    • Alternative electron transfer pathways to maintain function under varying conditions

When investigating these structural features, researchers should employ a combination of computational modeling, site-directed mutagenesis, and biophysical characterization. Consider that structural adaptations may correlate with P. putida's environmental versatility, including its ability to thrive under varying pH conditions and form specialized biofilms .

How can researchers effectively employ Box-Behnken Response Surface Methodology to optimize DsbB2 expression and activity?

Box-Behnken Design (BBD) for Response Surface Methodology (RSM) offers an efficient approach for optimizing DsbB2 expression and activity, requiring fewer experimental runs than traditional methods :

  • Experimental Design Setup:

    • Select three critical factors (e.g., temperature, inducer concentration, pH)

    • Establish three levels for each factor (low, medium, high)

    • Design experiments according to Box-Behnken principles, avoiding extreme combinations

  • Implementation Process:

StepProcedureTools/Methods
Factor SelectionIdentify key variables affecting DsbB2 expression/activityPreliminary screening experiments
Level DeterminationSet appropriate ranges for each factorLiterature review and pilot studies
Experimental MatrixGenerate Box-Behnken design matrixStatistical software (Minitab, Design Expert)
Data CollectionMeasure protein yield and enzymatic activityProtein quantification, activity assays
Model FittingFit second-order polynomial model to dataRegression analysis, ANOVA
Response Surface AnalysisGenerate 3D response surfaces and contour plotsVisualization software
OptimizationIdentify optimal factor combinationsNumerical optimization techniques
ValidationVerify predicted optimal conditions experimentallyConfirmatory experiments
  • Advantages for DsbB2 Research:

    • Efficiently maps the response surface with fewer runs than Central Composite Design

    • Avoids extreme conditions that might denature membrane proteins

    • Provides comprehensive understanding of factor interactions

    • Enables identification of optimal conditions for both expression and activity

When implementing this methodology, researchers should consider the sensitivity of DsbB2 to environmental conditions, particularly pH, as related disulfide bond formation proteins show differential responses to acidic and alkaline conditions .

How should researchers address inconsistent results when characterizing recombinant Pseudomonas putida DsbB2?

When encountering inconsistent results with recombinant P. putida DsbB2, implement this systematic troubleshooting approach:

  • Protein Expression Variability:

    • Verify plasmid stability through sequencing before and after expression

    • Standardize cell density at induction (OD600 = 0.6-0.8)

    • Control temperature precisely (±0.5°C) during expression

    • Validate protein identity via mass spectrometry after purification

  • Activity Assay Standardization:

    • Prepare fresh reagents for each experimental series

    • Include internal controls for normalization across experiments

    • Standardize protein concentration determination methods

    • Control buffer pH precisely, as disulfide bond proteins are pH-sensitive

  • Membrane Protein-Specific Issues:

    • Evaluate detergent effects by testing multiple detergent types and concentrations

    • Assess lipid composition influence on protein activity

    • Verify proper membrane incorporation using fractionation studies

    • Consider stability of transmembrane orientation during purification

  • Documentation and Statistical Analysis:

    • Document all experimental variables meticulously

    • Apply appropriate statistical tests to determine significance of variations

    • Consider using Box-Behnken experimental design to systematically identify variables affecting consistency

    • Implement standardized protocols across research group members

Remember that the functionality of disulfide bond formation proteins can be significantly affected by environmental conditions, particularly pH. The differential response of dsbA mutants to acidic versus alkaline conditions suggests that small variations in experimental pH could lead to substantial differences in results when working with DsbB2.

What are the most common pitfalls in interpreting functional assays for Pseudomonas putida DsbB2 and how can they be avoided?

Common pitfalls in DsbB2 functional assay interpretation and their solutions:

  • Misattributing Indirect Effects:

    • Pitfall: Assuming all phenotypic changes in dsbB2 mutants are direct results of DsbB2 absence

    • Solution: Implement complementation studies with controlled expression levels to verify direct causality

    • Validation: Use point mutations in catalytic cysteines to distinguish between catalytic and structural roles

  • Overlooking Redundancy in Disulfide Bond Formation Systems:

    • Pitfall: Failing to account for compensatory mechanisms in disulfide formation pathways

    • Solution: Create and analyze double/triple mutants affecting multiple components of disulfide bond formation systems

    • Approach: Employ systems biology tools to map redundant pathways affecting phenotypes of interest

  • Environmental Condition Inconsistencies:

    • Pitfall: Neglecting the influence of pH, temperature, or media composition on assay outcomes

    • Solution: Carefully control and document environmental parameters, particularly pH, which significantly affects dsbA mutant phenotypes

    • Implementation: Design multi-factorial experiments using response surface methodology to map condition-dependent behaviors

  • Improper Normalization and Controls:

    • Pitfall: Using inappropriate normalization methods for activity data

    • Solution: Normalize to appropriate cellular parameters (protein content, cell number) and include proper positive/negative controls

    • Standardization: Develop internal standards for each assay type to enable cross-experiment comparison

  • Confounding Biofilm and Planktonic Phenotypes:

    • Pitfall: Failing to distinguish between effects on biofilm versus planktonic cells

    • Solution: Separately analyze biofilm and planktonic populations using specialized collection methods

    • Importance: Critical given that disulfide bond formation protein mutations significantly affect biofilm formation and extracellular matrix production

When interpreting results, always consider the pleiotropic effects observed in disulfide bond formation protein mutants, which can impact stress response, biofilm formation, and plant interactions simultaneously .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.