Recombinant Pseudomonas putida Disulfide bond formation protein B 2 (dsbB2) is a bacterial oxidoreductase engineered for heterologous expression, primarily in E. coli. It belongs to the Dsb (disulfide bond) system, which facilitates the formation of disulfide bonds in nascent or misfolded proteins, ensuring proper folding and functional stability .
UniProt ID: P59344
Gene name: dsbB2
Synonyms: PP_0190, Disulfide oxidoreductase 2
The dsbB2 protein sequence (MLPARLRTFFLPACLVALAVLVASFRLENTVGLMPCPLCLSQRLLLGGYALLCFAAVLQA PGTRGILRYARLALGCSLAGALLAARHVWLQGAEGVNEVCPVPIGRVFEQSWSEAARQLL LGGPDCRSLAWSFLDLTLPEWSLLAFLLLAVLPLSCLLAYRFRTLART) includes a catalytic domain responsible for disulfide bond formation .
| Property | Value | Source |
|---|---|---|
| N-terminal tag | His-tag | |
| Protein length | 168 amino acids | |
| Molecular weight (estimated) | ~18.5 kDa (without tag) | |
| Purity | >90% (SDS-PAGE) |
dsbB2 is expressed in diverse hosts to optimize yield and functionality:
| Host System | Advantages | Applications |
|---|---|---|
| E. coli | High yield, rapid production | Recombinant protein studies |
| Yeast | Limited post-translational modifications | Structural studies |
| Baculovirus (insect) | Complex glycosylation (not required) | Functional assays (if needed) |
| Mammalian cells | Advanced PTMs (e.g., phosphorylation) | Rarely used for dsbB2 |
Note: E. coli and yeast are preferred for dsbB2 due to cost-effectiveness and shorter turnaround times .
dsbB2 catalyzes the oxidation of cysteine residues in target proteins, enabling disulfide bond formation. While its endogenous role in P. putida remains underexplored, recombinant dsbB2 is leveraged in biotechnological contexts:
Heterologous expression: dsbB2 supports the folding of disulfide-bond-dependent proteins in engineered P. putida strains, enhancing their utility as biosynthetic platforms for natural products (e.g., rhamnolipids, terpenoids) .
Stress tolerance: P. putida’s robust stress response systems, including efflux pumps and chaperones, synergize with dsbB2 to maintain protein stability under harsh conditions .
Expression: dsbB2 is typically expressed in E. coli under inducible promoters (e.g., T7).
Purification: His-tagged dsbB2 is purified via nickel affinity chromatography, yielding >90% purity .
Conjugation: Avi-tag biotinylated variants enable specific detection and immobilization .
| Parameter | Guideline | Rationale |
|---|---|---|
| Storage | -20°C/-80°C (aliquoted) | Prevent degradation |
| Reconstitution | Deionized water (0.1–1.0 mg/mL) | Maintain solubility |
| Freeze-thaw cycles | Minimize to ≤3 cycles | Avoid protein aggregation |
Buffer: Lyophilized dsbB2 is reconstituted in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .
Stability limitations: Repeated freeze-thaw cycles compromise activity, necessitating aliquoting for long-term storage .
Host compatibility: Yeast and mammalian systems may introduce unintended modifications, though dsbB2’s function is largely independent of eukaryotic PTMs .
Research gaps: Direct studies on dsbB2’s catalytic mechanism or substrate specificity in P. putida are lacking, limiting its targeted application in synthetic biology.
KEGG: ppu:PP_0190
STRING: 160488.PP_0190
Disulfide bond formation in Pseudomonas putida involves a coordinated system where DsbA functions as the primary oxidoreductase that directly catalyzes disulfide bond formation in substrate proteins, while DsbB2 serves as the membrane protein that reoxidizes DsbA to maintain the catalytic cycle. The deletion of dsbA in P. putida results in enhanced extracellular matrix production consisting of both capsular polysaccharides and exopolysaccharides, which promotes biofilm formation . This suggests that DsbB2, as part of this pathway, likely plays a crucial role in maintaining normal extracellular matrix production by ensuring proper DsbA function. The disruption of this relationship may lead to similar phenotypic changes observed in dsbA mutants, including altered stress responses and biofilm characteristics.
P. putida strains with mutations in disulfide bond formation proteins, specifically dsbA mutants, display differential sensitivity to pH conditions. These mutants show increased sensitivity to alkaline stress (pH 9.0-10.0) compared to wild-type strains . Interestingly, acidic conditions (pH 5.0) do not affect the mutants' survival but stimulate polysaccharide production and pellicle formation . This suggests that disulfide bond formation proteins like DsbB2 may be critical for maintaining protein stability and function under alkaline conditions. When designing experiments involving DsbB2, researchers should carefully control environmental pH, as it may significantly impact protein activity, stability, and physiological outcomes.
For analyzing dsbB2 expression in P. putida, a multi-faceted approach combining molecular and biochemical techniques is recommended:
Quantitative PCR (qPCR): For measuring transcript levels under various conditions
Western blotting: For protein quantification using specific antibodies
Reporter gene fusions: Construction of dsbB2-lacZ or dsbB2-gfp fusions to monitor expression in real-time
RNA-Seq: For genome-wide expression analysis to understand dsbB2 in context of other genes
When designing these experiments, it's crucial to include appropriate controls, such as housekeeping genes for qPCR normalization, and to test expression under various environmental conditions including different pH levels, as dsbA mutants show differential responses to acidic and alkaline conditions .
Purification of membrane proteins like DsbB2 requires specialized approaches:
| Purification Step | Method | Critical Parameters | Typical Yield |
|---|---|---|---|
| Expression System | E. coli BL21(DE3) with pET vector | Induction: 0.5 mM IPTG, 20°C overnight | 3-5 mg/L culture |
| Membrane Extraction | Detergent solubilization | 1-2% n-dodecyl-β-D-maltoside (DDM), 4°C | 70-80% recovery |
| Purification | Ni-NTA affinity chromatography | 20 mM imidazole (wash), 250 mM imidazole (elution) | 85-90% purity |
| Size Exclusion | Superdex 200 | Flow rate: 0.5 ml/min in 0.05% DDM buffer | >95% purity |
| Activity Preservation | Inclusion of lipids | 0.02-0.05% E. coli lipid extract | Maintains >80% activity |
When optimizing this protocol, consider that the presence of disulfide bonds in DsbB2 itself makes the protein susceptible to oxidative damage. Therefore, inclusion of reducing agents like 1-5 mM DTT during initial extraction, followed by controlled oxidation during later purification steps, may improve yields of properly folded protein. All buffers should be degassed and purification should be performed under nitrogen atmosphere when possible.
For comprehensive functional analysis of dsbB2 in P. putida, employ these genetic approaches:
Knockout Construction:
CRISPR-Cas9 system: Target specific dsbB2 sequences with minimal off-target effects
Homologous recombination: Replace dsbB2 with antibiotic resistance cassette flanked by 500-1000 bp homology regions
Suicide vector strategy: Use non-replicating plasmids carrying the knockout construct
Complementation System Design:
Inducible expression vectors: Use vectors with tightly regulated promoters (Ptac or PBAD)
Single-copy chromosomal integration: Employ mini-Tn7 transposon systems for stable expression
Native promoter constructs: Include 500 bp upstream of dsbB2 to maintain native regulation
Verification Methods:
Phenotypic analysis: Compare biofilm formation, polysaccharide production, and pH sensitivity
qRT-PCR: Confirm absence of dsbB2 transcript in knockouts and restored expression in complemented strains
Protein detection: Western blot analysis with specific antibodies
Based on observations from dsbA mutants, researchers should examine knockout phenotypes under both acidic and alkaline conditions, as different stress responses may be observed . Additionally, monitor extracellular matrix production and biofilm formation, as these are significantly affected in disulfide bond formation protein mutants.
To elucidate the comprehensive interaction network of DsbB2:
Crosslinking Mass Spectrometry (XL-MS):
Use membrane-permeable crosslinkers like DSS or DSP
Perform in vivo crosslinking followed by affinity purification
Identify interaction sites via LC-MS/MS analysis
Proximity-based Labeling:
Construct DsbB2-BioID or DsbB2-APEX2 fusion proteins
Allow biotinylation of proximal proteins in living cells
Purify biotinylated proteins and identify via mass spectrometry
Bacterial Two-Hybrid Analysis:
Create fusion constructs with split adenylate cyclase domains
Screen against genomic DNA library to identify novel interactors
Validate using co-immunoprecipitation or pull-down assays
Super-resolution Microscopy:
Tag DsbB2 with photoactivatable fluorescent proteins
Visualize subcellular localization and co-localization with other proteins
Perform time-lapse imaging to capture dynamic interactions
When implementing these techniques, researchers should carefully consider the membrane localization of DsbB2 and adjust protocols accordingly. Based on dsbA mutant studies, focus particularly on proteins involved in extracellular matrix production, stress response pathways, and biofilm formation, as these systems are significantly affected by disruption of disulfide bond formation proteins .
Based on research with dsbA mutants, the disulfide bond formation system plays a critical role in plant-microbe interactions. P. putida strains with enhanced biofilm formation capability, such as dsbA mutants, demonstrate increased efficiency in attaching to certain plant seeds, particularly tomato and pepper, resulting in longer germinated roots . This enhanced attachment leads to improved root colonization and plant growth promotion .
For researching DsbB2's role in this process:
Establish root colonization assays comparing wild-type and dsbB2 mutant strains using:
Fluorescently-labeled bacterial strains for microscopic visualization
Serial dilution plating of root homogenates for quantitative assessment
Confocal microscopy for spatial distribution analysis
Monitor plant growth parameters including:
Root length and architecture
Shoot biomass and development
Stress resistance indicators
Analyze plant-specific responses by testing multiple plant species, as the attachment phenotype varies between plant species (effective in tomato and pepper but not cucumber) .
The differential response across plant species suggests that each plant seed has unique surface properties or exudates that interact differently with bacterial attachment systems influenced by the disulfide bond formation pathway.
To investigate DsbB2's role in stress adaptation within the plant rhizosphere:
Rhizosphere Simulation Systems:
Develop microfluidic devices that mimic rhizosphere gradients
Create soil microcosms with controlled chemical composition
Establish plant-bacterial co-culture systems with real-time monitoring
Multi-omics Approaches:
Transcriptomics: RNA-Seq of bacteria under various rhizosphere conditions
Proteomics: Quantitative proteomics focusing on membrane and secreted proteins
Metabolomics: Profile metabolite exchange between plants and bacteria
Stress Response Assays:
pH challenge tests: Compare survival and gene expression at pH 5.0-10.0
Oxidative stress: Measure response to hydrogen peroxide and superoxide
Competitive fitness: Co-inoculate wild-type and mutant strains to assess relative fitness
Biochemical Analysis:
Measure activities of key stress response enzymes (catalases, peroxidases)
Quantify extracellular matrix components under different stress conditions
Analyze redox balance within bacterial cells during plant interaction
When designing these experiments, consider that dsbA mutants show differential sensitivity to pH, with particular vulnerability to alkaline conditions but enhanced polysaccharide production under acidic stress . Rhizosphere pH varies significantly depending on plant species, soil type, and root exudates, making it an important variable to control in these studies.
P. putida DsbB2 possesses several distinctive structural features compared to canonical DsbB proteins:
Transmembrane Domain Organization:
Four transmembrane segments arranged in a unique configuration
Larger periplasmic loops connecting transmembrane helices
Modified quinone-binding pocket with altered spatial arrangement
Catalytic Cysteine Residues:
Conserved CXXC motifs with species-specific residue preferences
Altered positioning of redox-active cysteines affecting electron transfer kinetics
Unique disulfide connectivity patterns during catalytic cycle
Quinone Interaction:
Specialized binding pocket accommodating specific quinone types
Modified quinone reduction mechanism optimized for Pseudomonas metabolism
Alternative electron transfer pathways to maintain function under varying conditions
When investigating these structural features, researchers should employ a combination of computational modeling, site-directed mutagenesis, and biophysical characterization. Consider that structural adaptations may correlate with P. putida's environmental versatility, including its ability to thrive under varying pH conditions and form specialized biofilms .
Box-Behnken Design (BBD) for Response Surface Methodology (RSM) offers an efficient approach for optimizing DsbB2 expression and activity, requiring fewer experimental runs than traditional methods :
Experimental Design Setup:
Implementation Process:
Advantages for DsbB2 Research:
When implementing this methodology, researchers should consider the sensitivity of DsbB2 to environmental conditions, particularly pH, as related disulfide bond formation proteins show differential responses to acidic and alkaline conditions .
When encountering inconsistent results with recombinant P. putida DsbB2, implement this systematic troubleshooting approach:
Protein Expression Variability:
Verify plasmid stability through sequencing before and after expression
Standardize cell density at induction (OD600 = 0.6-0.8)
Control temperature precisely (±0.5°C) during expression
Validate protein identity via mass spectrometry after purification
Activity Assay Standardization:
Membrane Protein-Specific Issues:
Evaluate detergent effects by testing multiple detergent types and concentrations
Assess lipid composition influence on protein activity
Verify proper membrane incorporation using fractionation studies
Consider stability of transmembrane orientation during purification
Documentation and Statistical Analysis:
Remember that the functionality of disulfide bond formation proteins can be significantly affected by environmental conditions, particularly pH. The differential response of dsbA mutants to acidic versus alkaline conditions suggests that small variations in experimental pH could lead to substantial differences in results when working with DsbB2.
Common pitfalls in DsbB2 functional assay interpretation and their solutions:
Misattributing Indirect Effects:
Pitfall: Assuming all phenotypic changes in dsbB2 mutants are direct results of DsbB2 absence
Solution: Implement complementation studies with controlled expression levels to verify direct causality
Validation: Use point mutations in catalytic cysteines to distinguish between catalytic and structural roles
Overlooking Redundancy in Disulfide Bond Formation Systems:
Pitfall: Failing to account for compensatory mechanisms in disulfide formation pathways
Solution: Create and analyze double/triple mutants affecting multiple components of disulfide bond formation systems
Approach: Employ systems biology tools to map redundant pathways affecting phenotypes of interest
Environmental Condition Inconsistencies:
Pitfall: Neglecting the influence of pH, temperature, or media composition on assay outcomes
Solution: Carefully control and document environmental parameters, particularly pH, which significantly affects dsbA mutant phenotypes
Implementation: Design multi-factorial experiments using response surface methodology to map condition-dependent behaviors
Improper Normalization and Controls:
Pitfall: Using inappropriate normalization methods for activity data
Solution: Normalize to appropriate cellular parameters (protein content, cell number) and include proper positive/negative controls
Standardization: Develop internal standards for each assay type to enable cross-experiment comparison
Confounding Biofilm and Planktonic Phenotypes:
Pitfall: Failing to distinguish between effects on biofilm versus planktonic cells
Solution: Separately analyze biofilm and planktonic populations using specialized collection methods
Importance: Critical given that disulfide bond formation protein mutations significantly affect biofilm formation and extracellular matrix production
When interpreting results, always consider the pleiotropic effects observed in disulfide bond formation protein mutants, which can impact stress response, biofilm formation, and plant interactions simultaneously .