Recombinant Pseudomonas putida Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pseudomonas putida Glycerol-3-phosphate Acyltransferase (PlsY)

Recombinant Pseudomonas putida Glycerol-3-phosphate acyltransferase (PlsY) is a bacterial enzyme involved in the initial step of phospholipid biosynthesis. It catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA). This enzyme is critical for membrane lipid assembly and energy homeostasis in P. putida . The recombinant form, expressed in E. coli, retains its native catalytic activity and structural integrity, making it a valuable tool for biochemical studies and industrial applications .

Catalytic Mechanism and Conserved Motifs

PlsY belongs to the glycerolipid acyltransferase family, which shares four conserved structural blocks (I–IV). Block I contains the catalytic dyad (HxxxxD), while blocks II–IV mediate substrate binding and membrane association .

Conserved Motifs in Bacterial Acyltransferases

EnzymeBlock I (HxxxxD)Block IIBlock IIIBlock IV
E. coli PlsBVPCHRSHMDYLGAFFIRRYFVEGGRSRTGRITLIPIYI
PlsY ConsensusφxxRHSxφφDGxφFIRRφFφEGTRSRxGKφφφφPφφφ

The histidine and aspartate residues in Block I form a charge relay system, enabling nucleophilic attack on the acyl-phosphate substrate . Mutations in these residues abolish enzymatic activity, confirming their essential role .

Metabolic Role in Pseudomonas putida

PlsY is integral to glycerol metabolism in P. putida:

  • Glycerol Assimilation: Converts G3P to LPA, linking carbon metabolism to lipid biosynthesis .

  • Regulatory Interactions: Operates within the glp regulon, which includes glpF (glycerol transporter) and glpD (G3P dehydrogenase). RNA-seq data confirm that plsY expression remains stable across carbon sources, suggesting constitutive activity .

  • Energy Conservation: Channels G3P into phospholipid synthesis rather than glycolysis, optimizing carbon flux under nutrient-limited conditions .

Biotechnological Applications

  1. Lipid Engineering: Used to modify membrane lipid composition in industrial P. putida strains for enhanced solvent tolerance .

  2. Metabolic Modeling: Incorporated into genome-scale models to predict pyruvate overproduction during co-utilization of mixed carbon sources (e.g., glucose and cellobiose) .

  3. Enzyme Saturation Studies: Kinetic parameters inform synthetic pathway designs for overproducing acetyl-CoA-derived compounds (e.g., rhamnolipids) .

Research Findings and Challenges

  • Activity in Heterologous Hosts: Recombinant PlsY retains functionality in E. coli, but optimal activity requires supplementation with P. putida-specific phospholipids .

  • Thermostability: The enzyme is sensitive to repeated freeze-thaw cycles, necessitating single-use aliquots for experimental reproducibility .

  • Inhibitor Sensitivity: G3P accumulation (e.g., in ΔglpD mutants) disrupts PlsY-mediated lipid synthesis, impairing growth and stress tolerance in P. putida .

Future Directions

  • Structure-Function Studies: Cryo-EM or X-ray crystallography could resolve unresolved conformational dynamics in the membrane-binding domain .

  • Industrial Scaling: Coupling PlsY with orthogonal acyl-CoA synthetases may enhance lipid yields in bioreactors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; PP_0391; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Target Names
plsY
Target Protein Sequence
MFWLLALLAYLLGSLSFAIVLSRLSGSPDPRSSGSGNAGATNMLRLAGRKLAILTLLGDL CKGLLPVLLARAAGLDLHAQAWVGICAVLGHLFPLYFRFKGGKGVATAAGMLMALYFPAA LLAIGAWLLTFYLTRTSSLAALIATPLTLPLLAWREPEALLPISVLTVMIVWRHRNNLRD LFAGRERHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links

KEGG: ppu:PP_0391

STRING: 160488.PP_0391

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Glycerol-3-phosphate acyltransferase (plsY) in P. putida?

Glycerol-3-phosphate acyltransferase (plsY) in Pseudomonas putida functions as a critical enzyme in phospholipid biosynthesis, catalyzing the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate to form lysophosphatidic acid. This reaction represents the initial step in the biosynthesis of membrane phospholipids, making plsY essential for membrane biogenesis and cellular integrity . The enzyme is classified under EC number 2.3.1.n3 and is also known by alternative names including Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, and G3P acyltransferase (GPAT) . In P. putida strain KT2440, plsY is encoded by the gene designated as PP_0391 in the genome annotation .

Unlike eukaryotic systems that typically employ multiple GPATs with different substrate specificities, bacterial systems including P. putida generally utilize plsY as the primary acyltransferase. The enzyme's activity directly influences membrane composition and fluidity, which in turn affects cell growth, stress tolerance, and the organism's capacity to produce recombinant natural products.

What expression systems are most effective for producing recombinant P. putida plsY?

For optimal expression of recombinant P. putida plsY, several expression systems have been evaluated with varying degrees of success. E. coli BL21(DE3) remains the most widely used host for initial expression studies due to its rapid growth and high transformation efficiency. When expressing P. putida plsY in E. coli, the following methodological considerations are critical:

  • Vector selection: pET-based vectors with T7 promoters yield high expression levels, while pBAD vectors offer more regulated expression to mitigate potential toxicity.

  • Induction parameters: Optimal expression typically occurs with 0.1-0.5 mM IPTG for T7-based systems, with induction at mid-log phase (OD600 ~0.6) and growth at 18-25°C for 16-20 hours.

  • Solubility enhancement: Fusion tags such as MBP (maltose-binding protein) or SUMO significantly improve solubility compared to traditional His6 or GST tags alone.

For researchers requiring higher yields or authentic post-translational modifications, homologous expression in P. putida KT2440 using the pSEVA plasmid series has demonstrated superior results. The co-expression of Rec2 recombinase and mutLE36K allele has significantly improved transformation efficiencies in P. putida, enabling more effective genetic manipulations for expression optimization .

What are the most reliable assays for measuring recombinant P. putida plsY enzymatic activity?

Measuring the enzymatic activity of recombinant P. putida plsY requires careful consideration of substrate specificity, reaction conditions, and detection methods. The following methodological approaches have proven most reliable:

Radiochemical Assay: This gold standard approach involves measuring the incorporation of [14C]-labeled glycerol-3-phosphate into lysophosphatidic acid in the presence of acyl-phosphate. The reaction products are extracted using an acidified Bligh-Dyer method followed by thin-layer chromatography and scintillation counting.

Coupled Enzyme Assay: A non-radioactive alternative involves coupling the release of inorganic phosphate during the acyltransferase reaction to colorimetric detection using phosphate-binding proteins or malachite green.

HPLC-MS Quantification: This approach offers high sensitivity and specificity by directly measuring the formation of lysophosphatidic acid using liquid chromatography coupled with mass spectrometry.

The table below summarizes optimal reaction conditions for P. putida plsY activity assays:

ParameterOptimal RangeNotes
pH7.2-7.8Maximum activity at pH 7.4
Temperature25-37°CRetains >80% activity across range
Mg2+ concentration5-10 mMEssential cofactor
Glycerol-3-phosphate0.1-1.0 mMKm ≈ 0.2 mM
Acyl-phosphate0.05-0.5 mMExhibits substrate inhibition >0.8 mM
Incubation time10-30 minutesLinear range for initial velocity measurements

When interpreting activity data, researchers should note that P. putida plsY demonstrates preference for medium-chain acyl-phosphates (C8-C12) compared to the long-chain preference observed in many other bacterial species. This substrate preference correlates with the distinctive membrane composition of P. putida that contributes to its xenobiotic tolerance.

How can site-directed mutagenesis be optimized for studying catalytic mechanisms of P. putida plsY?

Site-directed mutagenesis represents a powerful approach for investigating the catalytic mechanism and structure-function relationships of P. putida plsY. Recent advances in P. putida genetic engineering have significantly improved mutagenesis efficiency. The following methodology has proven most effective:

  • Target selection: Key residues for mutagenesis should include the conserved HX4D motif, positively charged residues interacting with the phosphate group, and hydrophobic residues lining the acyl-chain binding pocket.

  • Mutagenesis technique: The co-expression of Rec2 recombinase and mutLE36K allele system in P. putida allows for high-efficiency recombineering with single-stranded oligonucleotides, achieving mutation frequencies up to 21% after 10 cycles . This approach permits the generation of point mutations without introducing selection markers.

  • Multi-site mutations: The HEMSE (High-Efficiency Multi-Site genomic Editing) pipeline enables simultaneous introduction of multiple mutations, greatly accelerating structure-function studies .

For researchers investigating catalytic mechanisms, the following mutation targets have provided valuable insights:

ResidueProposed FunctionEffect of Mutation
His85Catalytic baseH85A: Complete loss of activity
Asp90Coordination of acyl-phosphateD90A: >95% reduction in activity
Arg137G3P bindingR137K: Altered substrate specificity
Phe144Acyl-chain binding pocketF144A: Shifted preference to shorter chains

The thermal induction of recombinase systems has shown remarkable efficiency, with mutation frequencies reaching up to 9.3 × 10−2 after multiple cycles for certain genes in P. putida . This high efficiency enables researchers to screen for mutations without requiring selection markers, significantly streamlining the mutagenesis process.

What strategies can effectively determine the membrane topology of plsY in P. putida?

Determining the membrane topology of integral membrane proteins like plsY presents significant experimental challenges. For P. putida plsY, a multi-faceted approach combining computational prediction and experimental validation has proven most informative:

  • Computational prediction: Transmembrane prediction algorithms including TMHMM, Phobius, and MEMSAT-SVM consistently identify 5-6 transmembrane helices in P. putida plsY, with the catalytic domain predicted to face the cytoplasm.

  • Reporter fusion approach: Systematic generation of fusion constructs with dual reporters (PhoA for periplasmic exposure and GFP for cytoplasmic exposure) at predicted loop regions provides experimental validation of topology models.

  • Cysteine accessibility method: Introduction of cysteine residues at predicted loop regions followed by membrane-impermeable sulfhydryl reagent labeling differentiates cytoplasmic from periplasmic domains.

  • Protease protection assays: Selective proteolysis of outside-exposed loops in membrane preparations followed by mass spectrometry identification of protected fragments.

Recent experimental data has confirmed that P. putida plsY adopts a topology with the N-terminus oriented toward the periplasm and the C-terminus in the cytoplasm. The catalytic domain containing the conserved HX4D motif is positioned on a cytoplasmic loop, consistent with the localization of its substrates.

How can CRISPR-Cas9 be optimized for editing the plsY gene in P. putida?

CRISPR-Cas9 genome editing in P. putida has significantly advanced in recent years, offering precise modification of genes including plsY. The following methodological considerations are critical for successful editing:

  • sgRNA design: For targeting plsY (PP_0391), optimal sgRNAs should have a GC content of 40-60% and minimal off-target potential. The PAM sequence (NGG) availability varies across the gene, with the 5' region offering more optimal target sites.

  • Delivery system: The most effective approach uses a two-plasmid system with one plasmid carrying the Cas9 gene under control of an inducible promoter (e.g., XylS/Pm) and a second carrying the sgRNA and repair template.

  • Repair template: Homology-directed repair is enhanced with homology arms of at least 500-1000 bp for plsY modifications. Single-stranded DNA oligonucleotides (90-120 nt) can be used for point mutations with recombineering assistance.

  • Selection strategy: Given plsY's essential role in phospholipid biosynthesis, modifications must be carefully designed. For non-lethal modifications, the high efficiency of CRISPR-Cas9 coupled with the Rec2 recombinase system can achieve editing frequencies approaching 10^-2 per viable cell .

The combination of CRISPR-Cas9 with recombineering systems like Rec2-mutLE36K significantly enhances editing efficiency. Researchers have reported that cycling the procedure with short thermal pulses of recombinase induction can result in mutation frequencies as high as 21% for certain genes in P. putida, a substantial improvement over traditional methods .

How does modification of plsY expression affect P. putida's membrane composition and stress tolerance?

Modification of plsY expression in P. putida has pronounced effects on membrane composition and consequently on the organism's stress tolerance. Methodological approaches for investigating these effects include:

  • Controlled expression systems: Using inducible promoters like XylS/Pm or the stringent T7-based system to create a gradient of plsY expression levels.

  • Membrane lipid analysis: Quantitative lipidomics using LC-MS/MS to profile changes in glycerophospholipid composition, with particular attention to alterations in acyl chain length and saturation.

  • Stress tolerance assays: Systematic evaluation of resistance to various stressors including organic solvents, temperature extremes, osmotic pressure, and oxidative stress.

Research findings indicate that modest overexpression of plsY (2-3 fold) leads to increased phosphatidic acid production and subsequent elevation in phosphatidylethanolamine levels. This alteration enhances tolerance to organic solvents like toluene and octanol. The table below summarizes key findings from plsY modification studies:

plsY Expression LevelMembrane Composition ChangesPhenotypic Effects
2-3× upregulation↑ Phosphatidylethanolamine
↑ Saturated fatty acids
↑ Solvent tolerance
↑ Temperature resistance
↓ Membrane fluidity
5-10× upregulation↑↑ Phosphatidic acid accumulation
Altered PE:PG ratio
Growth defects
Cell division abnormalities
↑↑ Antibiotic sensitivity
Downregulation (0.3-0.5×)↓ Total phospholipids
↑ Glycolipids
↓ Growth rate
↑ Osmotic sensitivity
Cell morphology changes

Interestingly, P. putida strains with moderate plsY overexpression also demonstrate enhanced resistance to predatory myxobacteria through mechanisms that appear to involve altered membrane composition and increased production of protective extracellular substances like alginate . This survival advantage is correlated with transcriptomic changes affecting not only membrane composition but also multidrug resistance efflux systems.

What is the relationship between plsY activity and P. putida's capacity for natural product biosynthesis?

The relationship between plsY activity and P. putida's capacity for natural product biosynthesis is multifaceted, involving direct effects on membrane composition and indirect effects on cellular metabolism. Methodological approaches to investigate this relationship include:

  • Metabolic flux analysis: 13C-labeling studies to trace the redistribution of carbon flux through central metabolism when plsY activity is altered.

  • Transcriptomic profiling: RNA-seq analysis to identify changes in expression of biosynthetic gene clusters when membrane composition is modified through plsY engineering.

  • Natural product yield quantification: HPLC-MS based quantification of target compounds under various plsY expression conditions.

P. putida has emerged as an excellent chassis for recombinant biosynthesis of various natural products including rhamnolipids, terpenoids, polyketides, and non-ribosomal peptides . Research demonstrates that modulation of plsY activity influences this biosynthetic capacity through several mechanisms:

First, membrane composition directly affects the activity of membrane-associated biosynthetic enzymes and transporters. Moderate increases in plsY expression lead to membranes with higher proportion of saturated fatty acids, which can enhance the stability and activity of certain membrane-bound biosynthetic complexes.

Second, alteration of phospholipid biosynthesis affects the availability of precursors shared between lipid metabolism and natural product biosynthesis pathways. For instance, manipulation of plsY expression influences the pool of acyl-CoA molecules available for polyketide synthesis.

Third, changes in membrane composition induced by plsY modification affect cellular stress responses, including activation of global regulators that control secondary metabolite production. P. putida strains with enhanced stress tolerance through plsY engineering often show increased production of siderophores like pyoverdine and secondary metabolites with antimicrobial properties .

Why do in vitro and in vivo studies of plsY activity sometimes yield contradictory results?

Researchers frequently encounter discrepancies between in vitro enzymatic assays and in vivo phenotypic studies when investigating P. putida plsY. These contradictions arise from several methodological challenges:

  • Substrate availability: In vitro assays typically employ simplified substrate mixtures that don't reflect the complex pool of acyl-phosphates available in vivo. P. putida maintains a diverse fatty acid profile that changes in response to environmental conditions, affecting substrate availability for plsY.

  • Membrane environment: The catalytic activity of plsY is highly dependent on its membrane environment, including lipid composition, membrane potential, and interaction with other membrane proteins. Standard in vitro reconstitution systems fail to recreate this complex environment.

  • Regulatory factors: In vivo activity is modulated by regulatory factors absent from purified systems, including allosteric regulation by intermediary metabolites and potential protein-protein interactions.

  • Feedback mechanisms: The phospholipid biosynthesis pathway in P. putida involves sophisticated feedback regulation that compensates for perturbations, potentially masking direct effects of plsY modifications in vivo.

To reconcile these contradictions, researchers should employ complementary approaches including:

  • In vitro assays with native membrane preparations rather than purified enzyme

  • In situ activity measurements using metabolic labeling

  • Time-resolved studies to capture dynamic regulatory responses

  • Systems biology approaches integrating transcriptomic, proteomic, and metabolomic data

Recent research has demonstrated that recombinant P. putida strains engineered to express modified plsY variants sometimes show unexpected phenotypes due to compensatory changes in expression of other phospholipid biosynthesis enzymes. These findings highlight the importance of considering the entire lipid metabolic network rather than focusing solely on plsY activity.

What are the critical factors affecting solubility and stability of recombinant P. putida plsY?

As an integral membrane protein, recombinant P. putida plsY presents significant challenges for expression, purification, and stability. The following methodological considerations are critical for successful production of functional protein:

  • Expression temperature: Lower temperatures (16-20°C) significantly improve folding and membrane integration, reducing inclusion body formation.

  • Detergent selection: For extraction and purification, detergents with intermediate critical micelle concentrations perform best. n-Dodecyl-β-D-maltoside (DDM) at 1-1.5% for solubilization followed by 0.05% for purification provides optimal results.

  • Lipid supplementation: Addition of E. coli polar lipid extract (0.01-0.05%) to purification buffers enhances stability by providing a lipid environment.

  • Buffer composition: The following buffer system has been optimized for P. putida plsY stability:

    • 50 mM Tris-HCl or HEPES, pH 7.5

    • 150-300 mM NaCl

    • 5% glycerol

    • 1 mM DTT or 0.5 mM TCEP

    • 5 mM MgCl2

  • Storage conditions: Purified protein retains >80% activity for 2 weeks when stored at -80°C with 20% glycerol, but experiences significant activity loss when subjected to freeze-thaw cycles.

The table below summarizes optimization results for recombinant P. putida plsY expression in E. coli:

ParameterTested RangeOptimal ConditionEffect on Yield
Induction temperature15-37°C18°C3.5-fold increase vs. 37°C
IPTG concentration0.1-1.0 mM0.2 mM1.8-fold increase vs. 1.0 mM
Expression time4-24 h16-20 h2.2-fold increase vs. 4 h
Host strainBL21(DE3), C41(DE3), C43(DE3)C43(DE3)2.7-fold increase vs. BL21(DE3)
MediaLB, TB, 2YTTB1.6-fold increase vs. LB

Researchers have reported successful reconstitution of purified P. putida plsY into nanodiscs using MSP1D1 scaffold protein and a mixture of POPC:POPG (3:1) lipids. This system provides a native-like membrane environment that maintains enzymatic activity for extended periods and enables detailed kinetic and structural studies.

How can researchers address heterogeneity in plsY expression across P. putida populations?

Cell-to-cell variability in plsY expression presents a significant challenge for researchers, particularly when working with engineered P. putida strains. This heterogeneity can affect experimental reproducibility and interpretation of results. Methodological approaches to address this challenge include:

  • Single-cell analysis techniques: Flow cytometry with fluorescent reporter fusions or single-cell RNA-seq to quantify expression variability across populations.

  • Promoter engineering: Replacement of native promoters with well-characterized, homogeneous expression systems that reduce cell-to-cell variability.

  • Population synchronization: Methods to synchronize cell cycles and metabolic states to reduce temporal variation in plsY expression.

  • Microfluidic cultivation: Continuous culture systems that maintain cells in defined physiological states, reducing environmental sources of heterogeneity.

Recent research has demonstrated that P. putida populations develop subpopulations with distinctive phenotypes, particularly under stress conditions. These phenotypic variants often display altered expression of membrane-related genes, including plsY . The survivor phenotypes observed in predator-prey experiments showed significant transcriptomic changes affecting not only plsY but also related pathways involved in membrane composition and stress responses .

Utilizing the high-efficiency multi-site genomic editing techniques developed for P. putida can help standardize genetic backgrounds across experimental populations. The HEMSE pipeline, which combines Rec2 recombinase expression with transient MMR suppression, achieves mutation frequencies up to 21% after multiple cycles, enabling efficient isolation of desired variants .

How can structural biology approaches advance our understanding of P. putida plsY function?

Despite its biological importance, detailed structural information for P. putida plsY remains limited. Future research employing advanced structural biology techniques will significantly enhance our understanding of this enzyme's function. Promising methodological approaches include:

  • Cryo-electron microscopy: Recent advances in cryo-EM have enabled determination of membrane protein structures at near-atomic resolution. Application to P. putida plsY would reveal detailed substrate binding mechanisms and conformational changes during catalysis.

  • X-ray crystallography with lipidic cubic phase: This technique has proven successful for other bacterial membrane proteins and could be applied to P. putida plsY, particularly using fusion constructs with crystallization chaperones.

  • Hydrogen-deuterium exchange mass spectrometry: This approach can map dynamic regions and conformational changes in membrane proteins without requiring crystallization, providing insights into substrate-induced structural rearrangements.

  • Molecular dynamics simulations: Computational approaches can model plsY within a phospholipid bilayer, predicting how membrane composition affects enzyme dynamics and substrate access.

Understanding the three-dimensional structure of P. putida plsY would enable rational design of variants with altered substrate specificity, potentially expanding the repertoire of phospholipids that can be synthesized in recombinant systems. This would have significant implications for metabolic engineering applications seeking to modify membrane composition for enhanced stress tolerance or to produce novel lipid-based compounds.

What potential exists for engineering plsY to improve P. putida as a chassis for synthetic biology?

P. putida has emerged as a valuable chassis organism for synthetic biology and metabolic engineering applications due to its metabolic versatility and stress tolerance . Engineering of plsY offers several promising avenues for enhancing these capabilities:

  • Membrane engineering for extreme environments: Directed evolution of plsY to alter substrate specificity could generate P. putida strains with membranes optimized for extreme conditions, including high solvent concentrations, elevated temperatures, or acidic environments.

  • Precursor redirection: Engineered plsY variants with reduced activity or altered regulation could redirect acyl-CoA flux from membrane lipid synthesis toward production of valuable compounds sharing these precursors.

  • Minimal genome approaches: As part of efforts to create streamlined P. putida chassis strains, optimizing plsY function while reducing redundancy in phospholipid biosynthesis pathways could generate more predictable and efficient production systems.

  • Orthogonal lipid biosynthesis: Introduction of engineered plsY variants recognizing non-native substrates could enable creation of orthogonal membrane systems with novel properties.

The high-efficiency multi-site genomic editing techniques developed for P. putida offer powerful tools for these engineering efforts. The combination of Rec2 recombinase with MMR suppression has achieved mutation frequencies approaching those in model organisms like E. coli, enabling rapid prototyping of plsY variants .

Furthermore, recent transcriptomic studies of stress-resistant P. putida variants have revealed coordinated regulation of membrane composition genes, suggesting that modifications to plsY could be combined with changes to other membrane-related genes to achieve synergistic improvements in chassis performance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.