Recombinant Pseudomonas putida Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
mscL; Pput_4507; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)
Target Names
mscL
Target Protein Sequence
MGVLNEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPLGLLIGGVDFSDLAIT LKAAEGDVPAVVLAYGKFIQTVIDFVIVAFAIFMGVKAINKLKREEAVAPTTPPVPSAEE TLLTEIRDLLKTQNQNRLP
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How should recombinant P. putida MscL protein be stored and handled in laboratory settings?

Recombinant P. putida MscL protein requires specific storage and handling protocols to maintain stability and functionality:

  • Storage conditions: Store the protein at -20°C/-80°C upon receipt. For extended storage, -80°C is preferred .

  • Aliquoting protocol: Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles which can degrade protein quality .

  • Working stock preparation: Store working aliquots at 4°C for up to one week .

  • Buffer composition: The protein is typically stored in Tris-based buffer with 50% glycerol (or Tris/PBS-based buffer with 6% Trehalose, pH 8.0) optimized for stability .

  • Reconstitution procedure: Prior to opening, briefly centrifuge the vial to bring contents to the bottom. Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, add glycerol to a final concentration of 5-50% (typically 50%) and aliquot before storing at -20°C/-80°C .

Proper handling ensures experimental reproducibility and prevents protein degradation through multiple freeze-thaw cycles.

What are the regulatory requirements for working with recombinant P. putida MscL in a research setting?

Researchers working with recombinant P. putida MscL must comply with institutional and governmental regulations regarding recombinant or synthetic nucleic acid (r/sNA) molecules:

  • Registration requirement: Principal Investigators (PIs) must register their r/sNA research materials whether they create, purchase, or obtain them from colleagues .

  • Institutional approval: Work must be approved by the Institutional Biological Safety Committee before initiation .

  • Containment level determination: Based on NIH Guidelines, typical recombinant bacterial protein work falls under different classifications:

    r/sNA Experiment TypeNIH SectionContainment Level
    Standard cloning vectors (<50% of Risk Group 2 pathogen)III-F, Appendix C-IExempt, BSL1
    Non-E. coli K12 r/sNA experimentsIII-EBSL1
    Insertion of DNA into Risk Group 2 pathogensIII-D-1BSL2 or higher
  • Protocol documentation: Detailed protocols must be maintained, including safety measures and waste disposal procedures .

  • Personnel training: All researchers handling the material must receive appropriate training on safe handling procedures.

It's important to note that a colleague's registration does not cover your research unless you are specifically added as an assistant to that PI and perform work in their laboratory under their responsibility .

How can MscL gene disruption in P. putida be leveraged for improved biopolymer recovery?

Engineered osmotic disruption in P. putida through MscL inactivation provides an efficient genetic platform for intracellular biopolymer recovery, particularly poly(3-hydroxyalkanoates) (PHAs). The methodological approach involves:

  • Genetic engineering strategy: Create a scarless mutation in the mscL gene (PP_4645) using homologous recombination techniques .

  • Complementary porin overexpression: Combine MscL inactivation with overexpression of outer membrane porins (OprF and OprE) to enhance membrane permeability and destabilization under osmotic stress .

  • Osmotic challenge protocol:

    • Grow engineered strains under PHA-producing conditions (e.g., using decanoate as carbon source)

    • Subject cells to osmotic upshift for 1 hour

    • Rapidly transfer to hypotonic conditions, creating osmotic shock

    • Monitor cell disruption over 3 hours

This approach leads to >95% cell lysis within 3 hours as confirmed by colony forming unit (CFU) counting and FACS analysis, allowing recovery of approximately 94% of synthesized mcl-PHA without significant alterations to final monomer composition .

The mechanism exploits the cellular vulnerability created when MscL-deficient cells cannot properly respond to hypotonic shock, leading to cellular rupture and efficient release of intracellular compounds. This method reduces downstream processing steps in biopolymer recovery workflows.

What experimental approaches can be used to characterize the electrophysiological properties of recombinant P. putida MscL?

Comprehensive characterization of recombinant P. putida MscL electrophysiological properties requires multiple complementary techniques:

  • Patch-clamp analysis:

    • Reconstitute purified MscL protein into artificial liposomes

    • Apply negative pressure to patches and measure single-channel currents

    • Determine conductance values and gating thresholds

    • Compare with established mechanosensitive channel parameters

  • Planar lipid bilayer recordings:

    • Form stable bilayers with defined lipid compositions

    • Insert purified MscL protein

    • Apply mechanical tension via osmotic gradients

    • Record channel opening events and conductance properties

    • Analyze dwell times and open probabilities

  • Fluorescence-based assays:

    • Label MscL protein with environment-sensitive fluorophores

    • Monitor conformational changes upon membrane tension application

    • Quantify tension-induced fluorescence changes

    • Correlate with functional states of the channel

  • Atomic force microscopy:

    • Image MscL-containing membranes at nanoscale resolution

    • Directly measure physical forces required for channel activation

    • Visualize structural changes during gating

For experimental preparation, researchers should use the full-length recombinant protein (amino acids 1-139) reconstituted in lipid compositions mimicking P. putida native membranes. Data analysis should include conductance measurements, open probability calculations, and tension-response curves to fully characterize the channel's mechanosensitive properties.

How does P. putida MscL function compare to homologous channels in other bacterial species?

Pseudomonas putida MscL shares fundamental mechanosensitive properties with homologs in other bacterial species, but exhibits distinct functional characteristics reflecting adaptation to its environmental niche:

SpeciesMscL Channel PropertiesOsmotic ResponseGating ThresholdSequence Homology to P. putida MscL
P. putidaInner-membrane rescue valveHypotonic shock responseModerate threshold100% (reference)
E. coliWell-characterized prototypeRapid response to hypotonicityWell-defined (~10 mN/m)Moderate (~70-80%)
P. aeruginosaFunctions with efflux systemsAssociated with antibiotic resistanceHigher thresholdHigh (~85-95%)
M. tuberculosisStructurally characterizedSlower gating kineticsHigher thresholdLow (~50-60%)

When comparing functional mechanisms:

  • Structural domain conservation: The transmembrane domains forming the channel pore are highly conserved across species, while cytoplasmic domains show greater variability .

  • Physiological role variations: In P. putida, MscL functions primarily in osmotic regulation and cellular homeostasis , while in pathogenic species like P. aeruginosa, mechanosensitive channels interact with other membrane components like efflux pumps and porin systems that contribute to antibiotic resistance mechanisms .

  • Experimental validation approach: To directly compare homologous channels, researchers should:

    • Express and purify recombinant MscL proteins from multiple species

    • Reconstitute in identical membrane compositions

    • Subject to standardized tension protocols

    • Measure electrophysiological parameters under identical conditions

    • Analyze functional differences in context of amino acid sequence variations

Understanding these comparative differences provides insights into bacterial adaptation and may inform antimicrobial development strategies targeting these essential osmotic regulation systems.

What are the optimal expression systems for producing recombinant P. putida MscL protein for structural studies?

Selecting the appropriate expression system is critical for obtaining high-quality recombinant P. putida MscL for structural studies. Based on current methodologies:

  • E. coli-based expression systems:

    • System: BL21(DE3) with pET-based vectors appears optimal for MscL expression

    • Induction protocol: IPTG induction (0.2-1.0 mM) at OD600 0.6-0.8

    • Growth temperature: Lower post-induction temperature (16-20°C) minimizes inclusion body formation

    • Affinity tags: N-terminal His-tag facilitates purification while minimally affecting protein folding

    • Advantages: High yield, well-established protocols

  • Cell-free expression systems:

    • Approach: Using purified ribosomes, RNA polymerase, and translation factors

    • Advantages: Avoids toxicity issues, allows incorporation of labeled amino acids

    • Disadvantages: Lower yield, higher cost

  • Membrane-mimetic environments:

    • Extraction: Use of mild detergents (DDM, LDAO, OG) for solubilization

    • Reconstitution: Nano-discs or lipid cubic phase for structural studies

    • Quality control: SEC-MALS and negative-stain EM to assess homogeneity

For crystallographic or cryo-EM studies, protein purity must exceed 95% as determined by SDS-PAGE , with homogeneity confirmed by size-exclusion chromatography. The storage buffer composition (Tris/PBS-based buffer with stabilizers like trehalose) is crucial for maintaining protein stability during structural studies.

Expression of membrane proteins like MscL requires careful optimization of membrane insertion efficiency while maintaining proper folding. The full-length construct (amino acids 1-139) ensures complete structural information, particularly for capturing the channel's mechanosensitive properties.

How can researchers design controlled osmotic challenge experiments to study MscL function in engineered P. putida strains?

Designing rigorous osmotic challenge experiments for studying MscL function requires precise methodology:

  • Strain engineering considerations:

    • Create deletion mutant (KTΔmscL) via scarless mutation using homologous recombination

    • Develop complementation strains expressing MscL under controlled promoters

    • Engineer strains with fluorescent reporters fused to osmotic stress response elements

  • Osmotic challenge protocol design:

    • Baseline growth: Establish standardized growth conditions (medium composition, growth phase)

    • Osmotic upshift phase: Add precisely calculated amounts of NaCl or sucrose to create hypertonic conditions (1 hour exposure)

    • Hypotonic shock phase: Rapid transfer to distilled water or hypotonic media

    • Time-course sampling: Collect samples at defined intervals (0, 0.5, 1, 2, 3 hours)

  • Quantitative assessment metrics:

    • Viability measurements: Colony forming units (CFU) on solid media

    • Flow cytometry: FACS analysis with viability dyes (propidium iodide)

    • Microscopy: Transmission electron microscopy for membrane integrity assessment

    • Osmotic stability: Measure cellular content release (protein, nucleic acids)

  • Data analysis framework:

    ParameterWild-typeMscL-deficientMscL-complemented
    Survival rate post-shockHighLow (<5% after 3h)Restored
    Cell lysis kineticsSlowRapidIntermediate
    Membrane integrityMaintainedCompromisedPartially maintained
    Cellular content releaseMinimalExtensive (>95%)Moderate
  • Controls and validation:

    • Wild-type strain subjected to identical conditions

    • Complementation with functional MscL to confirm phenotype rescue

    • Microscopic verification of cell morphology changes

    • Standardization of osmotic transition rates

This experimental design allows for quantitative assessment of MscL's role in osmotic stress resistance and provides a platform for testing modified versions of the channel to understand structure-function relationships.

What techniques can be used to visualize and track MscL localization and dynamics in bacterial membranes?

Advanced imaging techniques enable detailed visualization of MscL localization and dynamics within bacterial membranes:

  • Fluorescent protein fusion approaches:

    • Construct design: Create C- or N-terminal fusions of MscL with fluorescent proteins (GFP, mCherry)

    • Expression control: Use inducible promoters to achieve physiological expression levels

    • Validation: Confirm functionality of fusion proteins through complementation assays

    • Imaging: Confocal microscopy with z-stacking to visualize membrane localization

    • Limitations: Potential disruption of membrane insertion or channel function

  • Super-resolution microscopy techniques:

    • PALM/STORM: Photoactivatable fluorophores for single-molecule localization microscopy

    • STED microscopy: Achieves 30-50 nm resolution to resolve channel clustering

    • Experimental design: Fixed samples for static distribution or live imaging for dynamics

    • Analysis: Quantify cluster size, density, and co-localization with other membrane components

  • Single-particle tracking:

    • Labeling strategy: Quantum dots or photo-stable fluorophores conjugated to MscL via small tags

    • Acquisition: High-speed imaging (>10 frames/second)

    • Analysis: Mean square displacement calculations to determine:

      • Confined vs. free diffusion zones

      • Diffusion coefficients in different membrane environments

      • Effects of osmotic shock on mobility

  • FRET-based approaches:

    • Design: Dual-labeled MscL constructs to monitor conformational changes

    • Application: Real-time monitoring of channel opening during osmotic shifts

    • Quantification: FRET efficiency changes correlate with channel state

  • Correlative microscopy workflow:

    • Combine fluorescence imaging with electron microscopy

    • Precisely localize MscL channels in the context of bacterial ultrastructure

    • Visualize membrane deformations associated with channel activation

For optimal results, these techniques should be applied to both wild-type P. putida and the engineered strains (KTΔmscL complemented with tagged MscL) . Time-lapse imaging during osmotic challenge experiments provides dynamic information about channel redistribution and clustering in response to membrane tension changes.

What biosafety considerations apply when working with genetically modified P. putida strains expressing recombinant MscL?

Working with genetically modified P. putida strains expressing recombinant MscL requires adherence to specific biosafety protocols:

  • Risk assessment and containment level determination:

    • P. putida is generally considered Risk Group 1 (minimal hazard)

    • Recombinant work typically requires BSL-1 containment

    • Non-E. coli K12 recombinant experiments are classified under NIH Section III-E requiring BSL-1 containment

    • Work must be registered with and approved by institutional biosafety committees

  • Laboratory safety procedures:

    • Standard microbiological practices

    • Appropriate personal protective equipment (laboratory coat, gloves)

    • Biological safety cabinets for aerosol-generating procedures

    • Decontamination of all waste materials before disposal

  • Strain containment considerations:

    • Engineered osmolysis strains (KTΔmscL) may have reduced environmental viability

    • Implement physical containment measures to prevent environmental release

    • Maintain detailed records of strain construction and modification

  • Regulatory compliance documentation:

    • Document all genetic modifications according to institutional and national guidelines

    • Maintain detailed protocols including safety measures and waste disposal procedures

    • Ensure appropriate training for all personnel working with the strains

  • Special considerations for osmotic-sensitive strains:

    • Engineered strains with compromised osmotic regulation (KTΔmscL) require particular attention to prevent unintended lysis

    • Avoid exposure to hypotonic solutions during routine handling

    • Standardize protocols for consistent culture maintenance

It's important to note that while P. putida has a strong safety record in laboratory settings, recombinant strains must be handled according to established biosafety guidelines to prevent unintended environmental release or laboratory incidents.

How can researchers troubleshoot expression and purification challenges specific to recombinant P. putida MscL?

Troubleshooting expression and purification of recombinant P. putida MscL requires systematic approach to address membrane protein-specific challenges:

  • Expression optimization strategies:

    ChallengeTroubleshooting ApproachAssessment Method
    Poor expression levelTest different E. coli strains (C41/C43 for toxic proteins)Western blot with anti-His antibody
    Inclusion body formationLower induction temperature (16-20°C), reduce IPTG concentrationMembrane fraction analysis
    Protein toxicityUse tightly controlled inducible promoters, C41/C43 strainsGrowth curve analysis pre/post-induction
    Improper membrane insertionInclude fusion partners that promote membrane targetingMembrane fractionation studies
  • Solubilization optimization:

    • Systematically screen detergents (DDM, LDAO, Fos-choline-12)

    • Test different detergent concentrations and solubilization times

    • Evaluate solubilization efficiency by SDS-PAGE and Western blotting

    • Consider addition of stabilizing lipids during solubilization

  • Purification troubleshooting:

    • Optimize binding conditions for His-tagged protein

    • Test multiple buffer compositions to enhance stability

    • Add glycerol (5-50%) to prevent aggregation

    • Use size exclusion chromatography to separate aggregates

    • Consider on-column refolding for inclusion body-derived protein

  • Protein quality assessment:

    • Verify protein identity by mass spectrometry

    • Confirm proper folding by circular dichroism

    • Assess oligomeric state by SEC-MALS

    • Verify functionality through liposome reconstitution assays

  • Storage stability solutions:

    • Test different buffer compositions (Tris/PBS-based buffers)

    • Evaluate cryoprotectants (6% trehalose, 50% glycerol)

    • Aliquot to avoid freeze-thaw cycles

    • Compare different storage temperatures (-20°C vs. -80°C)

For difficult-to-express constructs, consider cell-free expression systems which can overcome toxicity issues, or fusion partners that enhance membrane protein expression (MBP, Mistic domain). Document optimization steps systematically to establish reproducible protocols for future work.

How should researchers analyze and interpret results from osmotic challenge experiments with MscL-deficient P. putida strains?

Proper analysis and interpretation of osmotic challenge experiment data requires rigorous methodological approaches:

  • Viability data analysis framework:

    • Plot survival curves showing CFU counts over time post-hypotonic shock

    • Calculate survival percentage relative to pre-shock values

    • Apply appropriate statistical tests (ANOVA with post-hoc comparisons) between strains

    • Compare MscL-deficient strains to both wild-type and complemented controls

  • Flow cytometry data interpretation:

    • Analyze fluorescence profiles to distinguish intact vs. compromised cells

    • Quantify population percentages in each category over time

    • Generate time-dependent transition curves for membrane integrity loss

    • Correlate with CFU data to validate findings

  • Electron microscopy analysis:

    • Evaluate morphological changes in cell envelope structure

    • Quantify visible membrane damage events

    • Compare ultrastructural features across strains

    • Develop quantitative scoring system for membrane damage severity

  • Integrated data interpretation model:

    ObservationWild-type InterpretationMscL-deficient InterpretationSignificance
    Rapid viability loss (<95% in 3h)Non-physiological stressExpected phenotype for osmotic vulnerabilityConfirms MscL role in protection
    Cell content releaseMembrane damage from excessive stressNormal consequence of MscL absenceValidates osmolysis mechanism
    Differential response among engineered strainsStrain-specific phenotypesComplementation level variationsStructure-function insights
  • Advanced analytical approaches:

    • Kinetic modeling of cell lysis rates to derive quantitative parameters

    • Principal component analysis of multiple measurement variables

    • Machine learning classification of cell morphology changes

    • Time-to-event analysis for precise determination of lysis dynamics

When interpreting results, researchers should consider that >95% cell lysis within 3 hours in MscL-deficient strains subjected to osmotic downshift represents a signature phenotype confirming MscL's critical role in osmotic stress protection . This can be leveraged for biotechnological applications like intracellular product recovery, while also providing fundamental insights into bacterial osmoregulation mechanisms.

What molecular modeling approaches can predict the structure-function relationships of P. putida MscL for protein engineering applications?

Advanced molecular modeling strategies provide powerful tools for exploring structure-function relationships in P. putida MscL to guide protein engineering:

  • Homology modeling workflow:

    • Identify suitable templates (E. coli or M. tuberculosis MscL crystal structures)

    • Generate sequence alignments prioritizing transmembrane regions

    • Build initial models using multiple modeling algorithms (MODELLER, SWISS-MODEL)

    • Refine models through energy minimization in membrane-mimetic environments

    • Validate models using PROCHECK, ERRAT, and VERIFY3D

  • Molecular dynamics simulation approach:

    • Embed modeled MscL in explicit lipid bilayers matching P. putida membrane composition

    • Equilibrate system under physiological conditions

    • Apply lateral membrane tension to simulate channel gating

    • Analyze:

      • Conformational changes during gating

      • Water/ion permeation events

      • Critical residue interactions

      • Energy barriers between states

  • Structure-based engineering prediction:

    RegionMutation TargetPredicted EffectApplication
    Hydrophobic gateIncrease hydrophobicityHigher gating thresholdStability in osmotic stress
    Transmembrane helicesModify helix-helix interactionsAltered gating kineticsControlled lysis timing
    Cytoplasmic domainCharge modificationsChanged ion selectivitySpecialized ion release
    Periplasmic loopsSurface modificationsAltered membrane interactionsMembrane anchoring control
  • Computational screening protocol:

    • Generate in silico mutation libraries based on evolutionary analysis

    • Perform virtual alanine scanning to identify critical residues

    • Use free energy perturbation calculations to predict stability changes

    • Rank mutations by predicted effect on channel function

  • Integration with experimental validation:

    • Design targeted mutations based on computational predictions

    • Express mutant proteins using established protocols

    • Test functional properties through electrophysiology

    • Validate predictions through osmotic challenge experiments

Structural analysis of the 139-amino acid sequence reveals key domains that can be targeted for engineering specific properties. For example, modifications to the hydrophobic gate region could create MscL variants with precisely tuned gating thresholds optimized for controlled cell lysis applications in biotechnology, while maintaining the core channel architecture necessary for proper membrane insertion and assembly.

What are the current technical limitations in studying P. putida MscL and how might they be overcome?

Current research on P. putida MscL faces several technical challenges that require innovative approaches:

  • Structural characterization limitations:

    • Challenge: Obtaining high-resolution structures of MscL in different conformational states

    • Current approaches: Detergent-based purification often destabilizes membrane proteins

    • Future solutions:

      • Lipid nanodiscs for native-like membrane environment

      • Application of cryo-EM for visualizing conformational heterogeneity

      • Development of conformation-specific antibodies as crystallization chaperones

  • Functional assay challenges:

    • Challenge: Real-time monitoring of channel activity in native membranes

    • Current limitation: Artificial systems may not replicate native membrane tensions

    • Advanced approaches:

      • Development of tension-sensitive fluorescent reporters

      • Application of high-speed atomic force microscopy for direct visualization

      • Microfluidic platforms for precise control of osmotic transitions

  • Genetic manipulation barriers:

    • Challenge: Precise control of MscL expression and modification in P. putida

    • Current limitation: Tools less developed than for model organisms

    • Emerging solutions:

      • CRISPR-Cas9 systems optimized for Pseudomonas

      • Development of tunable expression systems for controlled studies

      • Site-specific incorporation of unnatural amino acids for specialized probes

  • Integration of multiple datasets:

    • Challenge: Connecting molecular dynamics, structural data, and physiological responses

    • Current limitation: Disconnected experimental approaches

    • Future direction:

      • Multiscale modeling frameworks linking molecular events to cellular responses

      • Machine learning approaches to identify patterns across diverse datasets

      • Development of standardized experimental platforms for comparable data generation

By addressing these limitations through interdisciplinary approaches combining structural biology, biophysics, genetic engineering, and computational modeling, researchers can develop a more comprehensive understanding of P. putida MscL function and leverage this knowledge for biotechnological applications such as controlled cell lysis and intracellular product recovery .

What emerging applications might leverage engineered P. putida MscL beyond current biopolymer recovery approaches?

Engineered P. putida MscL systems offer promising opportunities beyond current biopolymer recovery applications:

  • Programmable biosensors for environmental monitoring:

    • Engineer MscL variants with modified gating thresholds sensitive to specific environmental stressors

    • Couple channel activation to reporter gene expression

    • Application: Real-time detection of environmental contaminants through engineered cell lysis and signal release

    • Advantage: Self-contained sensing systems with amplified signal output

  • Controlled release systems for biotechnology:

    • Develop precisely tunable MscL variants activated by specific triggers

    • Create genetic circuits linking industrial bioprocess parameters to MscL activation

    • Application: Timed release of high-value products from bacterial cell factories

    • Implementation: Design two-phase fermentation systems with growth and controlled lysis phases

  • Antimicrobial development platforms:

    • Exploit differences between MscL homologs in pathogens vs. non-pathogens

    • Screen for compounds that specifically activate pathogen MscL channels

    • Target: Develop selective antimicrobials exploiting essential osmotic regulation functions

    • Advantage: Novel mechanism distinct from conventional antibiotic resistance mechanisms

  • Synthetic cell engineering:

    • Incorporate engineered MscL variants into artificial cell systems

    • Create minimal cells with programmable osmotic response properties

    • Application: Development of robust synthetic cells for harsh environmental applications

    • Innovation: Osmotic control is fundamental to cell survival in fluctuating environments

  • Vaccine and therapeutic delivery systems:

    • Engineer probiotics with modified MscL for intestinal delivery of biologics

    • Trigger controlled lysis at specific gut locations through engineered sensitivity

    • Benefit: Protection of sensitive cargo until reaching target site

    • Implementation: Combine with gut-specific sensing mechanisms for precise delivery

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.