Recombinant Pseudomonas putida Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
msbA; PP_4935; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Target Names
msbA
Target Protein Sequence
MAETPRPAEHTSSLKIYFRLLSYVKPYVGIFLLSIVGFVIFASTQPMLAGILKYFVDGLS NPEAVLFPNVPYLRDLQLLQAVPLLIILIAAWQGLGSFLGNYFLAKVSLSLVHDLRVALF NKLLVLPNRYFDNHNSGHLISRITFNVTMVTGAATDAIKVVIREGLTVVFLFAYLLWMNW HLTLVMVAILPVIAVMVSIASKKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGGEAY EQQRFGQASQSNTDKQLRMTKTGSLYTPMLQLVIYSAMAALMFLVLFLRGDSTAGDLVAY ITAAGLLPKPIRQLSEVSSTIQKGLAGAESIFEQLDEAPEVDTGTVEKERVEGRLEVRNL SFTYPGTEREVLSDISFVAEPGQMIALVGRSGSGKSTLAALIPRFYHHDKGQILLDGVEI EHYRLRNLRRHVSQVTQHVTLFNDTVANNIAYGDLAGAPRADIEAAAADAYAKEFVDRLP KGFDTEVGENGVLLSGGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDHVM QGRTTLVIAHRLSTIEKADQILVMDQGRLVERGTHTELLAANGHYARLHAMGLDEPAKAD IT
Uniprot No.

Target Background

Function
This protein plays a crucial role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: ppu:PP_4935

STRING: 160488.PP_4935

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Pseudomonas putida MsbA protein?

Pseudomonas putida MsbA (msbA) is a homodimeric ATP-binding cassette (ABC) transporter composed of two transmembrane domains (TMDs) and two cytosolic nucleotide binding domains (NBDs). Each TMD contains six transmembrane (TM) helices. The full-length protein spans 602 amino acids (1-602) with the sequence beginning with MAETPRPAEH and ending with AKAD, as identified in recombinant expressions . The protein's structural organization follows the prototypical ABC transporter architecture, with the transmembrane helices forming a pathway through which substrates are transported across the membrane. The binding of ATP at the interface between the two NBDs drives conformational changes that enable substrate translocation through the membrane domains .

What is the primary function of MsbA in Gram-negative bacteria?

MsbA functions as an essential ATP-binding cassette transporter in Gram-negative bacteria that mediates the translocation of lipopolysaccharides (LPS) and lipid A from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane . This transport function is critical for bacterial cell envelope biogenesis and integrity. Studies have demonstrated that depletion or loss of function of MsbA results in the accumulation of LPS and phospholipids in the cytoplasmic membrane, underscoring its essential role in bacterial survival . Beyond its primary lipid transport role, MsbA has also been implicated in the efflux of certain amphipathic drugs, suggesting a potential secondary function in contributing to antimicrobial resistance mechanisms .

What are the optimal conditions for expressing recombinant P. putida MsbA protein?

For optimal expression of recombinant Pseudomonas putida MsbA protein, Escherichia coli has proven to be an effective heterologous expression system. The protein can be expressed with an N-terminal histidine tag to facilitate purification . When designing expression constructs, researchers should consider:

  • Expression vector selection: Vectors containing strong inducible promoters (T7, tac) are recommended

  • E. coli strain optimization: BL21(DE3) or equivalent strains designed for membrane protein expression

  • Induction conditions: Lower temperatures (16-25°C) often yield better-folded membrane proteins

  • Expression time: Extended expression periods (16-24 hours) at reduced temperatures

  • Membrane extraction: Careful solubilization using appropriate detergents such as n-dodecyl-β-D-maltoside (DDM)

The expression should be validated by SDS-PAGE analysis, with expected purity greater than 90% following affinity chromatography and subsequent purification steps .

What methods can be used to study MsbA-substrate interactions?

Multiple complementary approaches have been employed to investigate MsbA-substrate interactions:

TechniqueApplicationKey AdvantagesLimitations
Fluorescence labelingConformational changesCan detect subtle structural changesRequires chemical modification
X-ray crystallographyHigh-resolution structureAtomic-level details of bindingStatic snapshots only
Cryo-electron microscopyStructure in different statesVisualizes conformational variabilityLower resolution than X-ray
ATP hydrolysis assaysFunctional activityQuantitative measurement of activityIndirect measurement of transport
Reconstitution in liposomesTransport functionDirect measurement of translocationTechnical complexity
Computational simulationDynamic movementsInsights into conformational transitionsRequires validation

Fluorescent probe labeling with compounds such as MIANS (2-(4′-maleimidylanilino)naphthalene-6-sulfonic acid) at specific residues (e.g., C315) has been particularly useful. MsbA labeled with MIANS maintains high ATPase activity and normal folding while providing a sensitive reporter for conformational changes induced by substrate binding . Quenching experiments with this labeled protein can estimate binding parameters for various substrates including lipid A and amphipathic drugs .

How does the energetics of lipid transport by MsbA vary with different substrates?

The energetic requirements for MsbA-mediated lipid transport exhibit substrate-specific variations:

For long-acyl-chain phospholipids (specifically 1,2-dioleoyl (C18)-phosphatidylethanolamine), transport requires two distinct energy sources:

  • ATP binding and hydrolysis

  • A chemical proton gradient across the membrane

In contrast, for hexa-acylated (C12-C14) Lipid-A anchor of lipopolysaccharides, transport is exclusively ATP-dependent and does not require the proton gradient .

This differential energy requirement suggests that MsbA employs substrate-specific transport mechanisms, potentially involving different conformational states or binding interactions based on the physicochemical properties of the transported lipid. The dual energy requirement for certain substrates indicates a complex coupling mechanism between ATP hydrolysis and proton movement that warrants further investigation to fully elucidate the transport cycle .

What is the current understanding of the "trap and flip" model for MsbA-mediated lipid transport?

The "trap and flip" model for MsbA-mediated lipid transport is supported by structural evidence from X-ray crystallography studies. The model proposes:

  • Initial binding: Lipid A enters through a large amplitude opening in the transmembrane portal

  • Trapping: The substrate is captured within the transmembrane cavity

  • Conformational change: ATP binding drives a transition from inward-facing to outward-facing state

  • Flipping: This conformational change repositions the lipid from the inner to the outer leaflet

  • Release: The substrate is released into the periplasmic leaflet

This mechanism is supported by structural studies showing putative lipid A density inside the transmembrane cavity of MsbA . Additionally, electron density attributed to lipid A has been observed near an outer surface cleft at the periplasmic ends of the transmembrane helices, suggesting a possible post-transport docking site . The wide separation between the nucleotide-binding domains in the inward-facing conformation appears sufficient to accommodate lipid A entry, supporting the physiological relevance of this conformational state .

How do conformational dynamics influence MsbA transport function?

MsbA undergoes significant conformational changes during its transport cycle, which are critical for its function. Advanced biophysical studies have revealed:

  • Conformational states: MsbA samples a wide range of conformations, from a wide-open inward-facing state to a closed outward-facing state

  • Nucleotide influence: ATP binding and hydrolysis drive transitions between these states

  • Substrate effects: Binding of lipid A or amphipathic drugs alters the protein conformation

Multiple techniques have confirmed these dynamics, including X-ray crystallography, electron microscopy, computational simulation, cross-linking, fluorescence or luminescence resonance energy transfer (FRET/LRET), and electron spin resonance (EPR) spectroscopy .

The rate of MsbA labeling by fluorescent probes is reduced in the presence of amphipathic drugs, providing evidence that binding of these compounds induces conformational changes . The precise coordination between ATP hydrolysis cycles and the conformational transitions required for substrate transport remains an area of active investigation, particularly regarding how different substrates might influence these dynamics .

What approaches can resolve contradictory findings about MsbA's inward-facing conformation?

Contradictory findings regarding MsbA's inward-facing conformation, particularly the physiological relevance of the large separation between nucleotide-binding domains, can be addressed through:

  • Complementary structural techniques:

    • High-resolution cryo-EM in lipid nanodiscs to capture native-like states

    • Site-directed spin labeling combined with double electron-electron resonance

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

  • Functional validation:

    • Disulfide cross-linking to trap specific conformational states

    • Activity assays with conformation-specific inhibitors

    • Lipid transport assays in proteoliposomes with variants restricted to specific conformations

  • Molecular dynamics simulations:

    • Enhanced sampling techniques to explore the free energy landscape

    • Assessment of membrane effects on conformational stability

    • Simulation of substrate binding and transport pathways

Studies have shown that the 2.8 Å resolution structure of MsbA from Salmonella typhimurium displays an intermediate inward-facing conformation, with NBD separation between previously reported X-ray and EM structures . This suggests MsbA transitions through multiple conformational states, with the degree of opening potentially influenced by experimental conditions, bound substrates, and the presence of detergents versus native lipid environments .

How can researchers develop reliable in vitro lipid transport assays for MsbA?

Developing reliable in vitro lipid transport assays for MsbA requires careful consideration of several factors:

  • Protein reconstitution:

    • Purify MsbA to >90% homogeneity using affinity chromatography followed by size exclusion chromatography

    • Reconstitute into proteoliposomes with defined lipid composition

    • Ensure correct orientation (inside-out) for accessibility of ATP binding sites

  • Lipid substrate preparation:

    • For natural substrates, extract lipid A from appropriate bacterial sources

    • Alternatively, use synthetic lipid A analogs with fluorescent or radioactive labels

    • Incorporate lipid substrates during proteoliposome formation or add externally

  • Transport measurement approaches:

    • Fluorescence-based assays using labeled lipids with fluorescence quenchers on opposite sides of the membrane

    • NBD-labeled phospholipid analogs for FRET-based detection of flipping

    • Mass spectrometry to quantify transported unlabeled lipids after selective extraction

  • Controls and validation:

    • Include ATP-binding site mutants as negative controls

    • Compare transport rates with known modulators of ATPase activity

    • Measure ATP hydrolysis concurrently with transport to establish coupling ratios

These methodologies should consider the dual energy requirements identified for certain substrates, incorporating both ATP and the means to generate proton gradients across the proteoliposome membrane when studying phospholipid transport .

What structural approaches can reveal intermediate states in the MsbA transport cycle?

Capturing intermediate states in the MsbA transport cycle requires specialized structural approaches:

  • Time-resolved techniques:

    • Time-resolved cryo-EM with millisecond mixing devices

    • Time-resolved X-ray free electron laser crystallography

    • Temperature-jump triggered structural transitions

  • Conformational stabilization strategies:

    • ATP analogs with different hydrolysis rates (ATPγS, AMP-PNP)

    • Vanadate trapping to capture transition state during ATP hydrolysis

    • Engineered disulfide bonds to lock specific conformations

    • Conformation-specific nanobodies or antibody fragments

  • Single-molecule approaches:

    • Single-molecule FRET to monitor distance changes between labeled domains

    • High-speed atomic force microscopy for direct visualization of conformational changes

    • Optical tweezers to measure forces during conformational transitions

Researchers have successfully employed these approaches to identify an intermediate inward-facing conformation of MsbA, with the separation between NBDs falling between previously reported X-ray and EM structures . This intermediate state appears wide enough to allow lipid A access to the protein-enclosed transport pathway while representing a distinct step in the transport cycle .

How does P. putida MsbA compare functionally to homologs in other Gram-negative bacteria?

Comparative analysis of MsbA across different Gram-negative bacteria reveals important functional similarities and differences:

While the core function of lipid A transport is conserved across species, subtle differences in substrate specificity and energy coupling mechanisms may exist. These variations could reflect adaptations to the specific lipid A structures produced by different bacteria or environmental pressures faced by different species .

The evolutionary conservation of MsbA across Gram-negative bacteria underscores its essential role in outer membrane biogenesis. Despite variations in sequence, the core structural elements and transport mechanism appear to be preserved, suggesting fundamental constraints on the biochemical solutions to lipid A transport across the inner membrane .

What insights can be gained from studying P. putida MsbA for understanding drug efflux mechanisms?

Studying Pseudomonas putida MsbA provides valuable insights into drug efflux mechanisms:

  • Substrate promiscuity:

    • MsbA's ability to transport both lipid A and amphipathic drugs suggests structural features that accommodate diverse substrates

    • This flexibility may represent an ancestral function that specialized into dedicated drug efflux pumps

  • Drug binding characterization:

    • Fluorescence-based binding assays with labeled MsbA show that amphipathic drugs alter protein conformation

    • The initial rate of MsbA labeling by fluorescent probes is reduced in the presence of drugs, indicating conformational changes upon binding

  • Energy coupling mechanisms:

    • Understanding how MsbA couples ATP hydrolysis to transport can inform models for other ABC-type drug efflux pumps

    • The dual requirement for ATP and proton gradient for certain substrates suggests complex energy coupling mechanisms

  • Structure-function relationships:

    • Identifying drug binding sites in MsbA can guide rational design of efflux pump inhibitors

    • Comparing MsbA with dedicated multidrug transporters may reveal evolutionary adaptations for drug efflux

These investigations contribute to our broader understanding of intrinsic antibiotic resistance mechanisms in Gram-negative bacteria and may guide the development of novel approaches to overcome such resistance .

What are the primary challenges in working with recombinant MsbA and how can they be addressed?

Working with recombinant MsbA presents several technical challenges:

  • Protein stability issues:

    • Challenge: MsbA tends to aggregate during purification and storage

    • Solution: Add 6% trehalose to storage buffer at pH 8.0; avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week; reconstitute in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage at -20°C/-80°C

  • Maintaining native conformation:

    • Challenge: Detergents may disrupt native structure and function

    • Solution: Use stabilizing facial amphiphiles during crystallization; employ lipid nanodiscs for functional studies to better mimic native environment

  • Functional reconstitution:

    • Challenge: Achieving correct orientation and functionality in proteoliposomes

    • Solution: Optimize lipid composition; use gentle reconstitution methods; verify activity through ATPase assays

  • Substrate accessibility:

    • Challenge: Large substrates like lipid A are difficult to work with in vitro

    • Solution: Develop fluorescently labeled lipid analogs; utilize natural substrate extraction methods with high purity

  • Conformational heterogeneity:

    • Challenge: MsbA exists in multiple conformational states

    • Solution: Employ conformation-specific stabilizers; use complementary structural techniques to capture different states

These methodological solutions have enabled significant advances in studying MsbA, such as the high-resolution structural determination and functional characterization that have illuminated its transport mechanism .

How can researchers distinguish between lipid transport and drug efflux activities of MsbA?

Distinguishing between lipid transport and drug efflux activities of MsbA requires carefully designed experimental approaches:

  • Substrate-specific assays:

    • Lipid transport: Measure translocation of fluorescently labeled lipids in reconstituted proteoliposomes

    • Drug efflux: Monitor transport of fluorescent drug analogs or radiolabeled antibiotics

  • Competitive binding studies:

    • Compare binding affinities of lipids versus drugs

    • Determine if they compete for the same binding sites or can bind simultaneously

    • Use fluorescence quenching of MsbA-MIANS to quantify binding parameters

  • Mutational analysis:

    • Create variants with mutations in potential substrate binding sites

    • Identify mutations that selectively impact lipid transport versus drug efflux

    • Map substrate-specific interaction sites

  • Biophysical characterization:

    • Compare conformational changes induced by lipid binding versus drug binding

    • Analyze whether different substrates induce distinct structural states

  • Energy requirement analysis:

    • Determine if different energy coupling mechanisms exist for different substrates

    • Compare ATP hydrolysis rates and efficiency for lipid versus drug transport

    • Assess the role of proton gradient for different substrates as demonstrated for phospholipid versus lipid A transport

These approaches can help elucidate whether MsbA has evolved distinct mechanisms for handling different classes of substrates or employs a common transport pathway with differing affinities and energetic requirements .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.