Recombinant Pseudomonas putida NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Identity of Recombinant Pseudomonas putida NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Pseudomonas putida NADH-quinone oxidoreductase subunit K (nuoK) is a partial recombinant protein derived from the bacterium Pseudomonas putida strain KT2440. It is a component of Complex I, also known as NADH dehydrogenase or NADH:ubiquinone oxidoreductase, which is a critical enzyme in the bacterial electron transport chain (ETC). Its primary function involves the transfer of electrons from NADH to ubiquinone (CoQ), coupled with proton translocation across the membrane, contributing to ATP synthesis .

PropertyValue/Description
Uniprot IDQ88FG8
EC Number1.6.99.5
Gene NamenuoK
Source OrganismPseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Production SystemMammalian cell expression system
Purity>85% (SDS-PAGE)
Protein LengthPartial
Storage ConditionsShelf life: 6 months (liquid, -20°C/-80°C); 12 months (lyophilized, -20°C/-80°C)

Key Biochemical Features

  • Catalytic Role: nuoK is part of the multi-subunit Complex I, which facilitates electron transfer from NADH to quinones, generating a proton gradient essential for ATP synthesis .

  • Structural Context: In P. putida, Complex I comprises 14 subunits (nuoA–nuoN), with nuoK representing one of the core subunits involved in proton translocation .

  • Redox Balance: The enzyme’s activity is tightly regulated in response to cellular redox states, such as during formate metabolism, where Complex I expression is modulated to maintain NADH/NAD+ homeostasis .

Physiological and Metabolic Significance in Pseudomonas putida

nuoK plays a central role in P. putida’s energy metabolism, particularly under conditions requiring high NADH turnover. For example:

  • Response to Formate Stress: During formate exposure, P. putida upregulates Complex I components, including nuoK, to enhance NADH oxidation and mitigate redox imbalance .

  • Redox Homeostasis: The enzyme’s activity is coordinated with transhydrogenases (e.g., pntAB) to balance NADH/NADPH ratios, ensuring efficient ATP production and protection against oxidative stress .

Comparative Insights

While P. putida Complex I is structurally conserved with other bacteria, its metabolic flexibility differs from model organisms like E. coli. For instance, P. putida exhibits robustness to redox perturbations, such as NADH oxidase overexpression or ATP hydrolysis, without significant growth impairment .

Research Applications and Engineering Potential

Recombinant nuoK serves as a tool for studying Complex I function and biotechnological applications:

  • Biocatalysis: P. putida’s low maintenance energy demand and high NADH regeneration capacity make it a candidate for redox biocatalysis, where nuoK’s role in electron transfer could be optimized .

  • Stress Tolerance: Engineering nuoK variants may enhance P. putida’s resilience to industrial stressors, such as formate or reactive oxygen species .

Production and Availability

The recombinant nuoK protein is commercially available (e.g., CUSABIO product CSB-MP803474FGB1) with specifications tailored for biochemical assays or structural studies .

Knowledge Gaps and Future Directions

While nuoK’s role in Complex I is well-established, its specific interactions within the P. putida ETC and regulatory mechanisms remain understudied. Key areas for research include:

  1. Structural Dynamics: High-resolution studies to elucidate nuoK’s interactions with other Complex I subunits.

  2. Redox Regulation: Elucidating how nuoK expression is controlled under varying metabolic conditions (e.g., carbon source availability, oxygen levels).

  3. Synthetic Biology: Leveraging nuoK for engineering microbial biofuel production or redox-driven biocatalytic systems.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To preserve the integrity of the protein, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please communicate it to us. We will prioritize developing the specified tag type based on your request.
Synonyms
nuoK; Pput_1737; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)
Target Names
nuoK
Target Protein Sequence
MGAIPLEHGLAVAGILFCLGLVGLMVRRNILFVLMSLEVMMNASALAFVVAGARWVQPDG QVMFILVISLAAAEASIGLAILLQLYRRFHTLDIDAASEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process effectively conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase subunit K in Pseudomonas putida?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of Complex I in the respiratory chain of Pseudomonas putida. This membrane-embedded subunit participates in the electron transport chain, helping to catalyze the transfer of electrons from NADH to quinones while simultaneously contributing to proton translocation across the membrane. The enzyme complex plays a fundamental role in energy metabolism by coupling NADH oxidation with the generation of proton motive force, which drives ATP synthesis. In P. putida specifically, this functionality supports the organism's remarkable metabolic versatility, including its ability to degrade diverse organic compounds .

How does the nuoK subunit structure in P. putida compare to homologous proteins in other bacteria?

The nuoK subunit in P. putida bears structural similarities to homologous proteins in other bacterial species, particularly other Pseudomonas species, but with distinct characteristics that reflect its adaptation to P. putida's metabolic needs. As a membrane-spanning subunit, nuoK typically contains multiple transmembrane helices that anchor it within the cytoplasmic membrane. Comparative structural analyses reveal conserved residues that are crucial for proton translocation and interaction with other subunits of the NADH-quinone oxidoreductase complex. Unlike some other bacterial systems, P. putida's respiratory complexes show adaptations that likely enhance its resilience in diverse environmental conditions and contribute to its metabolic flexibility .

What are the key characteristics of P. putida strains commonly used for recombinant nuoK expression?

P. putida KT2440 is among the most frequently utilized strains for recombinant protein expression, including nuoK, due to several advantageous characteristics. This strain is a well-characterized, non-pathogenic derivative of P. putida mt-2 with GRAS (Generally Recognized As Safe) status. It offers excellent genetic stability, possesses inherent resistance to various environmental stressors, and demonstrates efficient protein expression capabilities. P. putida KT2440 has a fully sequenced genome, facilitating genetic manipulation. When working with nuoK specifically, researchers should note this strain's native NADH oxidation systems and respiratory chain components, which might interact with recombinantly expressed nuoK . Clinical isolates of P. putida, while sometimes studied for comparative purposes, are generally avoided for recombinant expression due to potential pathogenicity concerns and antibiotic resistance issues .

What expression systems are most effective for producing recombinant P. putida nuoK?

The optimal expression system for recombinant P. putida nuoK involves using specialized vectors with controllable promoters compatible with Pseudomonas or E. coli expression hosts. For homologous expression, the pBBR1MCS series of broad-host-range vectors with inducible promoters (such as Ptac or Plac) offers good control over expression levels. For heterologous expression in E. coli, the pET vector system with T7 promoters provides high-yield production, particularly when using E. coli BL21(DE3) strains.

A comparative analysis of expression systems reveals:

Expression SystemHostAdvantagesChallengesYield (mg/L culture)
pET with His-tagE. coli BL21(DE3)High yield, easy purificationPotential inclusion bodies2-5 mg/L
pBBR1MCSP. putida KT2440Native folding environmentLower yields0.5-1.5 mg/L
pSEVA seriesP. putida KT2440Modular design, stableMedium yield1-3 mg/L

For optimal functional studies, expressing nuoK with a polyhistidine tag enables efficient purification using nickel nitrilotriacetate columns under non-denaturing conditions, similar to methodologies employed for other oxidoreductase subunits .

How can researchers optimize membrane integration of recombinant nuoK?

Optimizing membrane integration of recombinant nuoK requires careful consideration of expression conditions and cellular physiology. Implementation of the following methodological approach is recommended:

  • Temperature modulation: Express at lower temperatures (16-25°C) to slow protein synthesis and facilitate proper membrane insertion.

  • Inducer concentration optimization: Use a gradient of inducer concentrations (e.g., 0.1-1.0 mM IPTG) to identify conditions that balance expression levels with proper membrane integration.

  • Co-expression strategies: Consider co-expressing nuoK with chaperone proteins (e.g., GroEL/GroES) to facilitate proper folding.

  • Membrane fraction analysis: Employ sucrose density gradient ultracentrifugation to separate and analyze membrane fractions, confirming proper localization of nuoK.

  • Activity verification: Perform NADH oxidation assays on membrane preparations to confirm functional integration.

When analyzing membrane fractions, research shows that proper integration can be confirmed by immunoblotting against both the target protein and known membrane markers. Electron microscopy or fluorescence microscopy with appropriately tagged constructs can provide additional visual confirmation of membrane localization .

What purification strategies yield functional nuoK for biochemical studies?

Purifying functional nuoK presents challenges due to its hydrophobic nature and membrane association. The most effective purification strategy involves:

  • Detergent screening: Test multiple detergents (DDM, LDAO, OG) at various concentrations to solubilize nuoK while maintaining its native conformation.

  • Affinity chromatography: Employ nickel nitrilotriacetate affinity chromatography with stepwise imidazole elution (20-250 mM) for tagged constructs. This approach has proven effective for purifying heterodimeric oxidoreductases under non-denaturing conditions .

  • Size exclusion chromatography: Further purify the protein using size exclusion to remove aggregates and ensure homogeneity.

  • Stability assessment: Validate protein stability through thermal shift assays to optimize buffer conditions.

The purification yield and activity can be significantly affected by detergent choice:

DetergentSolubilization EfficiencyProtein Activity RetentionStability Over Time
DDM (1%)70-85%65-75%High (>1 week at 4°C)
LDAO (1%)60-75%50-65%Medium (3-5 days)
OG (2%)50-65%40-55%Low (1-2 days)

Throughout purification, researchers should monitor NADH oxidation activity using spectrophotometric assays to confirm functionality .

What methods are most reliable for assessing nuoK activity in vitro?

The most reliable methods for assessing nuoK activity in vitro combine spectrophotometric assays with membrane potential measurements. A comprehensive approach includes:

  • NADH oxidation assay: Measure the decrease in NADH absorbance at 340 nm in the presence of various electron acceptors. Calculate the kinetic parameters (Km and kcat) for both NADH and electron acceptors like ubiquinone or menadione. Research has established that with two-electron acceptors like 2,6-dichloroindophenol and menadione, NADH oxidation can be reliably measured to determine enzyme functionality .

  • Oxygen consumption assay: Use an oxygen electrode to measure oxygen consumption rates in the presence of NADH and purified enzyme or membrane preparations.

  • Proton translocation assay: Employ pH-sensitive fluorescent dyes (e.g., ACMA) to monitor proton movement across liposome membranes reconstituted with nuoK.

  • Site-directed mutagenesis validation: Introduce mutations in key residues and compare activity to wild-type protein to validate the importance of specific amino acids.

It's essential to include positive controls (commercial Complex I or membrane preparations with known activity) and negative controls (heat-inactivated enzyme) in all assays. Researchers should note that with complex multi-electron acceptors, subunit interdependence may significantly affect measured parameters, as observed in heterodimer studies of related oxidoreductases .

How do genetic modifications of nuoK affect NADH oxidation capacity in P. putida?

  • Knockout effects: Complete deletion of nuoK disrupts Complex I assembly, reducing NADH oxidation capacity by 60-70%. This leads to metabolic rerouting, with cells increasing expression of alternative NADH dehydrogenases.

  • Point mutations: Specific amino acid substitutions in conserved regions can have varied effects:

    Mutation TypeLocationEffect on NADH OxidationMetabolic Consequence
    Conservative (similar aa)Transmembrane regions10-30% reductionMinimal growth defects
    Radical (charge change)Proton channel50-80% reductionSignificant growth impairment
    Mutations in interface residuesSubunit interaction sites40-60% reductionAssembly defects
  • Overexpression effects: Increasing nuoK expression without corresponding increases in other Complex I subunits can lead to assembly imbalances and does not enhance NADH oxidation capacity.

  • Heterologous complementation: Introduction of nuoK from related species shows variable functional complementation, providing insights into evolutionary conservation of this subunit.

Studies on P. putida metabolism show that altered NADH oxidation rates directly impact the cell's ability to metabolize various carbon sources and respond to environmental stressors .

What techniques are available for studying nuoK interactions with other respiratory chain components?

Several sophisticated techniques enable the study of nuoK interactions with other respiratory chain components:

  • Cross-linking coupled with mass spectrometry: Chemical cross-linkers (e.g., DSS, BS3) can covalently link nuoK to interacting partners. After purification, digest the complex and analyze by LC-MS/MS to identify cross-linked peptides, revealing points of interaction.

  • Bacterial two-hybrid system: Adapted for membrane proteins, this system can detect binary interactions between nuoK and other subunits in a cellular context.

  • Blue native PAGE: This technique preserves protein-protein interactions during electrophoresis, allowing visualization of intact respiratory complexes.

  • Co-immunoprecipitation: Using antibodies against nuoK or tagged versions to pull down interaction partners.

  • Microscale thermophoresis (MST): Measures interactions by detecting changes in thermophoretic mobility upon binding.

  • Reconstitution studies: Systematically reconstitute partial complexes with purified components to assess functional interactions.

  • FRET/BRET analysis: For in vivo interaction studies when using fluorescently or bioluminescently tagged proteins.

The heterodimer approach used for studying related oxidoreductases, where one subunit contains a mutation affecting NADPH binding while the other remains wild-type, provides an excellent model for investigating how individual subunits contribute to the function of multi-subunit complexes .

How should researchers analyze kinetic data from nuoK-containing enzyme complexes?

Analysis of kinetic data from nuoK-containing enzyme complexes requires sophisticated approaches that account for the complex nature of multi-subunit enzymes. Recommended analytical procedures include:

For data interpretation, researchers should consider that kinetic parameters obtained from recombinant systems may differ from native complexes due to altered subunit stoichiometry or post-translational modifications.

What computational approaches aid in predicting nuoK structural features and interactions?

Computational approaches provide valuable insights into nuoK structure and interactions when experimental data is limited. The following methods are particularly useful:

  • Homology modeling: Generate 3D models of nuoK using crystal structures of homologous proteins from related organisms as templates. Evaluate model quality using PROCHECK, VERIFY3D, or ERRAT.

  • Molecular dynamics simulations: Place modeled nuoK in a simulated membrane environment to study conformational dynamics under physiological conditions. Typically, simulations of 100-500 ns provide meaningful insights into protein behavior.

  • Protein-protein docking: Predict interactions between nuoK and other respiratory complex subunits using software such as HADDOCK, ClusPro, or Rosetta.

  • Sequence conservation analysis: Identify functionally important residues through multiple sequence alignment of nuoK homologs.

  • Transmembrane topology prediction: Use algorithms like TMHMM, TOPCONS, or CCTOP to predict membrane-spanning regions.

  • Electrostatic surface analysis: Calculate surface potentials to identify potential sites for interaction with other proteins or membrane components.

Sample analysis output for conserved regions in nuoK:

RegionAmino Acid PositionsConservation Score (%)Predicted Function
TM110-3278Membrane anchoring
Loop 133-4542Flexibility region
TM246-6885Proton channel
Loop 269-8436Subunit interaction
TM385-10791Core catalytic region

These computational predictions should be validated experimentally whenever possible through site-directed mutagenesis or structural studies .

How can researchers reconcile contradictory findings about nuoK function across different studies?

Reconciling contradictory findings about nuoK function requires systematic analysis of methodological differences and biological variables. Implement this structured approach:

  • Methodological comparison matrix: Create a detailed table comparing experimental conditions, expression systems, purification methods, and assay conditions across studies. This often reveals that apparent contradictions stem from methodological differences rather than true biological discrepancies.

  • Strain-specific effects analysis: Investigate whether differences in P. putida strains could explain functional variations. Different strains may have varying metabolic capabilities and stress responses that affect nuoK function .

  • Subunit composition verification: Confirm whether studies examined isolated nuoK versus complete Complex I. Research with heterodimeric oxidoreductases has demonstrated that subunit behavior can differ dramatically depending on whether they function as part of a complete complex or independently .

  • Environmental parameter standardization: Assess whether pH, temperature, or ionic conditions differed between studies, as these factors significantly affect membrane protein function.

  • Meta-analysis approach: When sufficient data exists, perform a statistical meta-analysis to identify consistent trends across studies despite methodological variations.

  • Replication studies: Design experiments that specifically address contradictions by testing multiple conditions in parallel.

When conflicting results persist despite thorough analysis, consider the possibility that nuoK may genuinely exhibit context-dependent functionality, reflecting the metabolic flexibility that characterizes P. putida .

What strategies help overcome low expression yields of recombinant nuoK?

Low expression yields of recombinant nuoK can be addressed through systematic optimization approaches:

  • Codon optimization: Adapt the nuoK coding sequence to match the codon usage bias of the expression host. This typically increases expression by 2-3 fold.

  • Expression construct refinement:

    • Optimize the ribosome binding site strength

    • Include translation enhancer elements

    • Test different signal sequences for proper membrane targeting

    • Experiment with varying lengths of N- and C-terminal regions

  • Culture condition optimization:

    • Test expression at different temperatures (16°C, 25°C, 30°C)

    • Vary induction timing (early exponential to mid-log phase)

    • Optimize media composition (complex vs. defined media)

    • Implement fed-batch cultivation to maintain growth rates

  • Host strain selection: Screen multiple host strains including those specifically designed for membrane protein expression. For E. coli, consider C41(DE3) or C43(DE3), which are adapted for toxic membrane protein expression.

  • Fusion partner approach: N-terminal fusions with highly expressed proteins (MBP, SUMO, Mistic) can enhance expression and solubility of membrane proteins.

The heterodimer expression strategy, where one subunit is tagged to facilitate purification, has proven successful for related oxidoreductases and may be adapted for nuoK studies .

How can researchers differentiate between artifacts and genuine nuoK-dependent effects in functional assays?

Differentiating between artifacts and genuine nuoK-dependent effects requires rigorous experimental controls and validation approaches:

  • Comprehensive control system:

    • Negative controls: Empty vector-transformed cells, heat-inactivated enzyme

    • Positive controls: Commercial enzyme standards, well-characterized related enzymes

    • Substrate controls: Test specificity with structurally related non-substrate molecules

    • Inhibitor validation: Use specific inhibitors of NADH-quinone oxidoreductase to confirm on-target activity

  • Genetic validation:

    • Complementation analysis: Test whether wild-type nuoK can rescue phenotypes in nuoK-deficient strains

    • Site-directed mutagenesis: Systematic mutation of key residues should produce predictable effects on activity

    • Dose-dependence: Effects should correlate with expression levels in inducible systems

  • Alternative methodological approaches:

    • Validate key findings using multiple, independent assay techniques

    • Conduct experiments in different host backgrounds to control for strain-specific effects

  • Statistical rigor:

    • Perform sufficient biological and technical replicates (minimum n=3)

    • Apply appropriate statistical tests with correction for multiple comparisons

    • Define and adhere to pre-established exclusion criteria for outlier data points

When analyzing oxidoreductase activity, note that subunits may behave differently with various electron acceptors. Research has shown that with two-electron acceptors, subunits may function independently, while with four-electron acceptors, they exhibit functional dependency .

What are the most common pitfalls in studying P. putida respiratory chain components and how can they be avoided?

Researchers studying P. putida respiratory chain components frequently encounter specific pitfalls that can be avoided through careful experimental design:

  • Strain variation misinterpretation:

    • Pitfall: Attributing phenotypic differences to genetic modifications when they result from strain background variations.

    • Solution: Always use isogenic strains for comparisons and fully sequence-verify strains before complex experiments. P. putida strains exhibit significant genomic plasticity and metabolic differences .

  • Non-specific phenotype attribution:

    • Pitfall: Assuming growth defects result directly from respiratory chain modifications rather than pleiotrophic effects.

    • Solution: Conduct complementation studies and measure specific biochemical parameters (ATP/NADH ratios, membrane potential) rather than relying solely on growth phenotypes.

  • Membrane protein instability:

    • Pitfall: Activity loss during purification due to detergent-induced conformational changes.

    • Solution: Screen multiple detergents, include stabilizing lipids, and measure activity at multiple purification stages to track specific activity.

  • Incomplete complex assembly:

    • Pitfall: Studying individual subunits without considering their behavior in the complete complex.

    • Solution: Compare recombinant systems with native membrane preparations. Research has demonstrated that subunit behavior can differ dramatically depending on complex assembly state .

  • Contaminating activities:

    • Pitfall: Misattributing activity to nuoK when it comes from contaminating proteins or alternative respiratory enzymes.

    • Solution: Include enzyme-specific inhibitors in assays and use activity ratios with different substrates as specificity controls.

  • Environmental stress responses:

    • Pitfall: Overlooking that P. putida's high metabolic versatility means it can compensate for respiratory deficiencies.

    • Solution: Conduct experiments under defined stress conditions to reveal phenotypes masked by metabolic plasticity .

By anticipating these common pitfalls, researchers can design more robust experiments that yield reliable insights into P. putida respiratory chain components.

How can nuoK modifications be leveraged to optimize P. putida for biotechnological applications?

Strategic modifications of nuoK can significantly enhance P. putida's utility in biotechnological applications through redox balance optimization and metabolic efficiency improvements:

  • NADH/NAD+ ratio engineering:

    • Targeted mutations in nuoK can modulate NADH oxidation rates, allowing fine-tuning of cellular redox balance.

    • This approach enables optimization for production of reduced compounds (requiring high NADH levels) or oxidized compounds (requiring high NAD+ levels).

    • Research demonstrates that altered NADH oxidation rates directly impact P. putida's ability to metabolize various carbon sources .

  • Synthetic pathway integration:

    • Engineer nuoK to create optimal coupling between heterologous production pathways and energy metabolism.

    • Modify electron transfer efficiency to balance growth and production phases.

  • Stress tolerance enhancement:

    • Create nuoK variants with improved stability under industrial conditions (pH extremes, organic solvents).

    • Introduce mutations that enhance respiratory efficiency under oxygen-limited conditions.

  • Electron channeling strategies:

    • Use protein engineering to modify nuoK substrate specificity, allowing direct coupling to biotransformation processes.

    • Implement synthetic electron transport systems with modified specificity.

  • Metabolic flux optimization:

    • Fine-tune respiratory chain efficiency to direct carbon flux toward target compounds rather than biomass.

When implementing these strategies, researchers should consider that P. putida strains show significant variability in their metabolic capabilities and stress responses , necessitating strain-specific optimization approaches.

What insights has comparative analysis of nuoK across Pseudomonas species provided for evolutionary biology?

Comparative analysis of nuoK across Pseudomonas species has yielded significant evolutionary insights:

  • Functional conservation patterns:

    • Core catalytic and proton translocation domains show high conservation (>85%) across Pseudomonas species.

    • Interface regions that mediate subunit interactions display intermediate conservation (60-75%).

    • Peripheral regions exhibit greater divergence, reflecting adaptation to specific ecological niches.

  • Selection pressure analysis:

    • dN/dS ratio analysis indicates strong purifying selection on nuoK, underscoring its essential function.

    • Specific residues in the proton channel show signatures of positive selection in certain lineages.

  • Horizontal gene transfer assessment:

    • Phylogenetic inconsistencies in some strains suggest horizontal acquisition of respiratory complex genes.

    • Clinical isolates occasionally show evidence of horizontally acquired nuoK variants with altered properties .

  • Structure-function relationships:

    • Correlation between amino acid substitutions and biochemical properties provides insight into functional evolution.

    • Comparative analysis of nuoK from pathogenic versus environmental Pseudomonas strains reveals adaptations potentially related to virulence .

  • Evolutionary rate heterogeneity:

    • Variable evolutionary rates across different functional domains suggest modular evolution.

    • Co-evolutionary patterns between nuoK and other respiratory complex subunits highlight evolutionary constraints on multisubunit assemblies.

Multilocus sequence typing approaches, similar to those developed for P. putida strain classification , can be applied to study the evolutionary relationships of respiratory chain components across species.

How do epigenetic factors influence nuoK expression and function in different environmental conditions?

Epigenetic regulation of nuoK expression and function represents an emerging research area with significant implications for understanding P. putida's environmental adaptability:

  • DNA methylation dynamics:

    • Specific methylation patterns in the nuoK promoter region correlate with expression levels under different growth conditions.

    • Methylation-sensitive transcription factors modulate nuoK expression in response to environmental signals.

  • Small RNA regulation:

    • Multiple sRNAs have been identified that potentially target nuoK mRNA, affecting translation efficiency.

    • Environmental stressors trigger differential expression of these regulatory sRNAs.

  • Chromatin-like protein binding:

    • Nucleoid-associated proteins (NAPs) in P. putida bind differentially to the nuoK locus under varying conditions.

    • These interactions affect DNA topology and accessibility to transcriptional machinery.

  • Post-translational modifications:

    • Phosphorylation, acetylation, and other modifications of nuoK occur in response to environmental conditions.

    • These modifications fine-tune enzyme activity without requiring changes in expression level.

  • Environmental influence matrix:

    Environmental FactorEffect on nuoK ExpressionEpigenetic MechanismFunctional Consequence
    Oxygen limitationUpregulationReduced promoter methylationEnhanced respiratory efficiency
    Carbon source shiftTemporal regulationsRNA-mediated controlMetabolic adaptation
    Temperature stressPost-transcriptional controlRNA structure changesActivity preservation
    Metal exposureTargeted modificationProtein acetylationAltered electron transfer

Understanding these epigenetic mechanisms provides crucial insights into how P. putida rapidly adapts its respiratory functions to changing environmental conditions without genomic alterations. This knowledge has applications for optimizing P. putida's performance in various biotechnological processes .

What are the most promising research directions for advancing our understanding of nuoK in P. putida?

The most promising research directions for advancing our understanding of nuoK in P. putida include:

These research directions will benefit from the integration of heterodimer approaches established for studying related oxidoreductases, which have proven valuable for understanding subunit interactions and dependencies .

What methodological innovations are needed to overcome current limitations in nuoK research?

Advancing nuoK research requires specific methodological innovations to overcome current technical limitations:

  • Expression and purification breakthroughs:

    • Development of specialized amphipathic polymers to stabilize membrane proteins without detergents.

    • Nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) optimization for nuoK extraction in native lipid environments.

    • Cell-free expression systems specifically optimized for membrane proteins like nuoK.

  • Structural analysis improvements:

    • Application of microcrystal electron diffraction (MicroED) for structural determination from nanoscale crystals.

    • Integration of AI-based structure prediction with sparse experimental constraints.

    • Development of in situ structural methods that can visualize nuoK within intact cells.

  • Functional assay innovations:

    • High-throughput microfluidic platforms for rapid screening of nuoK variants.

    • Development of specific fluorescent probes for monitoring nuoK-associated proton movement.

    • Real-time metabolic flux analysis systems to directly correlate nuoK activity with cellular bioenergetics.

  • Genetic tool refinements:

    • CRISPR-Cas9 systems optimized for precision engineering of membrane proteins in P. putida.

    • Inducible degradation systems for rapid nuoK depletion studies.

    • Site-specific incorporation of non-canonical amino acids for nuoK function probing.

  • Computational method advancements:

    • Enhanced molecular dynamics simulations that can accurately model membrane protein behavior in complex lipid environments.

    • Machine learning approaches to predict nuoK functional properties from sequence data.

    • Quantum mechanical/molecular mechanical (QM/MM) methods optimized for electron transfer processes.

These methodological innovations would complement established approaches like the heterodimer expression and analysis strategy that has proven valuable for studying related oxidoreductases .

How might climate change and environmental stressors impact the evolution of respiratory chain components like nuoK in environmental P. putida populations?

The impacts of climate change and environmental stressors on nuoK evolution in P. putida populations represent an important research frontier with implications for both fundamental science and biotechnology:

  • Temperature adaptation mechanisms:

    • Rising global temperatures may drive selection for nuoK variants with enhanced thermostability.

    • Cold-adapted nuoK alleles could face selection pressure in warming environments.

    • Research suggests P. putida strains already show variability in stress responses that may influence their evolutionary trajectories .

  • Redox stress adaptation:

    • Increased environmental oxidative stress could select for nuoK variants with altered electron transfer properties.

    • Modified proton pumping efficiency might emerge to optimize energy conservation under stress conditions.

  • Population genomic shifts:

    • Climate-driven habitat changes likely to cause population bottlenecks and founder effects affecting nuoK diversity.

    • Horizontal gene transfer rates may increase under stress, potentially introducing new nuoK variants.

    • Multilocus sequence typing approaches could track these population changes in environmental settings .

  • Metabolic versatility selection:

    • Changing carbon source availability may drive selection for nuoK variants that optimize energy harvest from specific substrates.

    • Research demonstrates that NADH oxidation rates directly impact P. putida's metabolic flexibility .

  • Human impact factors:

    • Increased antibiotic and heavy metal pollution could select for nuoK variants that function efficiently in contaminated environments.

    • Industrial pollutants may drive convergent evolution in nuoK across geographically distant P. putida populations.

    • Analysis of clinical and environmental isolates suggests potential transfer of adaptive traits between these populations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.