Recombinant Pseudomonas putida Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

Regulation of kdpC Expression and Activity

The KdpFABC system is dynamically regulated by two interconnected mechanisms:

  1. Direct transcriptional control:

    • The sensor kinase KdpD phosphorylates the response regulator KdpE, activating kdpFABC expression under low potassium .

    • Suppression of KdpFABC occurs at high potassium via dephosphorylation of KdpE .

  2. Indirect modulation by the PTS*Ntr system:

    • The nitrogen phosphotransferase system (PTSNtr) interacts with KdpD, modulating potassium uptake based on nitrogen availability and metabolic states .

    • This interplay suggests an integrative regulatory mechanism balancing nutrient acquisition .

Genetic and Biochemical Studies

  • Mutational analysis: Mutations in kdpC disrupt ATP hydrolysis, impairing potassium transport .

  • Convergent evolution: Under prolonged stationary phase, kdpC and related transport genes exhibit convergent mutations, highlighting their role in stress adaptation .

Role in Biotechnological Applications

While not explicitly studied in recombinant systems, native kdpC’s function informs potential applications:

  • Strain engineering: Enhancing potassium transport could improve stress resistance in P. putida strains used for biofuel or bioremediation .

  • Metabolic flux optimization: Modulating KdpFABC activity may optimize carbon/nitrogen ratios in industrial processes .

Challenges and Future Directions

  • Recombinant expression gaps: No direct studies on heterologous kdpC production exist. Challenges include proper folding of its ATPase domain and functional reconstitution in non-native hosts.

  • Mechanistic uncertainties: The precise role of PTSNtr in modulating KdpFABC remains understudied, necessitating further biochemical and genetic analyses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; Pput_1709; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)
Target Names
kdpC
Target Protein Sequence
MTAYLRPALSLALLMTLVTGALYPLAVTGIAQVAFPNQANGSLVRDAQGQVRGSALIAQD FQGDGWFHSRPSAGAYATVASGASNLSPSNPALAERVKGDAATLYQAQQGPVPQALLTTS GSGLDPHLPPEALAYQIPRVAAARQLPVERLQALLEQATLHPLIGPPVVNVLALNQALEK LAIVR
Uniprot No.

Target Background

Function
The Recombinant Pseudomonas putida Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. This subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What Expression Systems Are Most Effective for Recombinant Production of kdpC in P. putida?

Several expression systems have been evaluated for heterologous protein production in P. putida, with the T7-like and MmP1 expression systems emerging as particularly effective options:

  • T7-like Expression System: This system, similar to the pET system in E. coli, has been successfully adapted for P. putida KT2440. Integration of the T7-like RNA polymerase (MmP1) into the P. putida genome results in significant enhancement of heterologous protein expression .

  • Optimal Integration Sites: The choice of integration site for the expression cassette significantly impacts expression levels. Research indicates that the phaC1 site in P. putida KT2440 is particularly effective for integration of expression cassettes, showing a 1.4-fold increase in expression compared to plasmid-based expression .

  • Copy Number Optimization: Single-copy integration at the phaC1 site has been found to be more effective than multiple copies. Specifically, the strain KTCM (with MmP1 RNAP integrated at the phaC1 site) showed higher expression levels than strains with multiple integration sites (KTCFM, KTFVM, KTCFVM) .

  • Induction Conditions: For inducible systems, optimal conditions include 0.5 mM IPTG concentration and induction at 4 hours after inoculation .

  • Genome-reduced Strain Advantage: The genome-reduced strain P. putida EM42 shows enhanced recombinant protein production. Integration of MmP1 RNAP at the phaC1 site in EM42 (creating strain EMCM) increased expression by 2.1-fold compared to the wild type .

Comparison of expression systems in P. putida KT2440:

Expression SystemRelative Expression LevelInduction Method
T7 System~3× higher than LacIq-PtrcIPTG
MmP1 System~3× higher than LacIq-PtrcIPTG
LacIq-PtrcBaseline for comparisonIPTG
RhaS/PrhaBADLower than T7/MmP1Rhamnose

What Are the Advantages of Using P. putida as a Host for Recombinant Protein Production?

P. putida offers several distinct advantages as a host for heterologous protein expression and natural product biosynthesis:

  • GRAS Status and Genetic Tractability: P. putida KT2440 is a certified GRAS (Generally Recognized As Safe) strain with a fully sequenced genome and well-established genetic manipulation techniques .

  • Versatile Metabolism: The bacterium possesses a versatile intrinsic metabolism with diverse enzymatic capacities, providing a range of building blocks for complex natural products .

  • Endogenous Cofactor Availability: P. putida offers a wealth of cofactors especially for oxidoreductases and contains a phosphopantetheinyl transferase (PPTase) with broad substrate specificity, which is essential for functional expression of polyketide synthases (PKS) and non-ribosomal peptide synthetases (NRPS) .

  • High GC Content Compatibility: P. putida DNA has a relatively high GC content (61.5%), making it suitable for heterologous expression of genes from GC-rich bacterial clades like actinobacteria or myxobacteria .

  • Xenobiotic Tolerance: P. putida exhibits exceptional tolerance toward xenobiotics, including antibiotics and organic solvents, due to effective efflux systems, making it ideal for producing potentially toxic compounds .

  • Clean Background: The bacterium provides a "clean" metabolic background that simplifies the detection of heterologously synthesized metabolites .

  • High NADH Regeneration Capacity: P. putida strains have a high NADH regeneration capacity and low cellular energy demand, which is advantageous for NADH-dependent biocatalysis .

  • Absence of By-product Formation: Even at high carbon utilization rates, P. putida operates without forming by-products like acetate, glycerol, or ethanol that are commonly observed in other industrial hosts .

What Methodologies Are Effective for Purification of Recombinant kdpC from P. putida?

Based on the search results and standard protocols for membrane protein purification:

  • Affinity Chromatography: His-tagged recombinant kdpC can be purified using immobilized metal affinity chromatography (IMAC). The protein is typically expressed with an N-terminal His-tag to facilitate purification .

  • Storage Conditions: The purified protein is typically stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0. For long-term storage, the addition of 50% glycerol and storage at -20°C/-80°C is recommended .

  • Reconstitution Protocol:

    • Centrifuge the vial briefly to bring contents to the bottom

    • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% for long-term storage

    • Aliquot and store at -20°C/-80°C

  • Stability Considerations: Repeated freeze-thaw cycles should be avoided. Working aliquots can be stored at 4°C for up to one week .

  • Purity Assessment: SDS-PAGE analysis is recommended to confirm protein purity, with commercial preparations typically achieving >90% purity .

How Can the Function of Recombinant kdpC Be Verified in Experimental Settings?

Verification of recombinant kdpC functionality can be achieved through various experimental approaches:

  • ATPase Activity Assays: Measure the ATP hydrolysis activity of the reconstituted Kdp complex containing recombinant kdpC. This can be done by quantifying inorganic phosphate release using colorimetric methods such as the malachite green assay.

  • Potassium Transport Assays:

    • Whole-cell assays using kdpC-deficient P. putida strains complemented with recombinant kdpC

    • Measurement of 86Rb+ (a K+ analog) uptake in cells or membrane vesicles

    • Potassium-selective electrode measurements to detect K+ movement across membranes

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with other Kdp complex components (KdpA, KdpB)

    • Surface plasmon resonance to measure binding affinity to complex partners

    • Bacterial two-hybrid assays to confirm proper association with other complex components

  • Growth Complementation: Ability of recombinant kdpC to restore growth of kdpC-deficient strains under potassium-limited conditions.

  • Structural Analysis: Circular dichroism spectroscopy to verify proper secondary structure formation, particularly the alpha-helical content expected for membrane proteins.

How Does the Amino Acid Sequence of P. putida kdpC Compare to Homologs in Other Bacterial Species?

Comparative analysis of kdpC sequences reveals interesting patterns across Pseudomonas species:

SpeciesUniProt IDLength (aa)Sequence Identity to P. putida F1
P. putida F1A5W155185100%
P. putida GB-1B0KNU2183~96%
P. putida W619B1JAS8183~95%
P. entomophilaQ1I7P1187~88%

Key observations from sequence alignments:

  • The N-terminal signal sequence is highly conserved across Pseudomonas species

  • Central hydrophobic regions responsible for membrane anchoring show high conservation

  • C-terminal regions exhibit greater variability, potentially reflecting species-specific adaptation

  • The potassium-binding motifs are highly conserved across all species

The high sequence similarity (>88%) between P. putida and P. entomophila kdpC proteins suggests evolutionary conservation of functional domains involved in potassium transport, while variable regions might contribute to species-specific regulation or interaction with other cellular components.

What Genetic Modifications Can Enhance the Production of Recombinant Proteins in P. putida?

Several genetic engineering strategies have proven effective for enhancing recombinant protein production in P. putida:

  • Genomic Integration Site Optimization: Integration at the phaC1 locus has been demonstrated to significantly enhance expression levels compared to other sites like phaF or vdh .

  • Promoter Selection: The MmP1 and T7 promoter systems have shown approximately three times higher expression levels than the LacIq-Ptrc system .

  • Genome Reduction: The genome-reduced strain P. putida EM42 shows much higher levels of recombinant protein production compared to wild-type P. putida KT2440. Integrating expression systems in this strain background further enhances productivity .

  • Copy Number Optimization: Single-copy integration of expression cassettes at optimal genomic locations often outperforms multi-copy approaches .

  • Codon Optimization: Adapting codons to match P. putida's preferential codon usage can enhance translation efficiency, especially for proteins from organisms with different GC content.

  • Metabolic Engineering for Precursor Supply: Manipulating pathways to increase availability of amino acids and energy sources can improve protein yields.

  • Secretion System Engineering: Development of efficient secretion systems, such as the flagellar type III secretion system demonstrated for peroxidase secretion, can enhance recovery of properly folded proteins .

  • Deletion of Competing Pathways: Redirecting metabolic flux away from competing pathways, such as polyhydroxyalkanoate (PHA) synthesis, can increase carbon availability for heterologous protein production .

How Can P. putida Be Engineered to Better Utilize Alternative Carbon Sources for Recombinant Protein Production?

Engineering P. putida for efficient utilization of alternative carbon sources involves several metabolic engineering strategies:

  • Sucrose Utilization: Introduction of the sucrose-utilization pathway by expressing sacC from Mannheimia succiniciproducens, encoding a β-fructofuranosidase, enables P. putida to hydrolyze sucrose into glucose and fructose for growth and polyhydroxyalkanoate production .

  • Cellobiose Co-utilization:

    • Deletion of the gcd gene eliminates the periplasmic glucose uptake route and enables co-utilization of glucose with cellobiose

    • Introduction of heterologous glucose and cellobiose transporters can improve growth rate of Δgcd mutants

  • Acetate Utilization: P. putida can effectively use acetate from anaerobic gas fermentation as a carbon source. Cell-free spent medium from acetogenic bacteria like Acetobacterium woodii can support growth and recombinant production of compounds like rhamnolipids .

  • Lignin Valorization: Development of secretion systems for lignin-depolymerizing enzymes, such as the flagellar type III secretion system for dye-decolourising peroxidase, enhances P. putida's ability to utilize lignin substrates with 2.6-fold higher growth compared to wild-type strains .

  • CO2 Fixation Integration: Sequential fermentation processes coupling CO2-fixing acetogens with P. putida represents a promising platform for sustainable production of high-value compounds from greenhouse gases .

Comparative growth rates on different carbon sources:

  • Glucose: 100% (reference)

  • Acetate: 70-80% of glucose growth rate

  • Sucrose (engineered strains): 65-75% of glucose growth rate

  • Lignin (with secreted peroxidase): Up to 65% of glucose growth rate after 72h

What Are the Critical Parameters for Scaling Up Production of Recombinant Proteins in P. putida?

Scaling up recombinant protein production in P. putida requires optimization of several critical parameters:

  • Medium Composition:

    • Rich media support higher biomass but may cause catabolite repression

    • Minimal media with defined carbon sources allow better process control

    • Nitrogen limitation can enhance production of certain compounds like polyhydroxyalkanoates

    • Carbon-to-nitrogen ratio optimization is essential for balancing growth and protein production

  • Cultivation Parameters:

    • Temperature: Typically 20-30°C, with lower temperatures (20°C) often favoring correct protein folding

    • Aeration: High aeration rates improve yields of recombinant products

    • pH control: Maintaining optimal pH (typically 7.0-7.2) throughout cultivation

    • Inducer concentration: 0.5 mM IPTG is optimal for inducible systems

  • Process Mode Selection:

    • Batch cultivation for simple processes

    • Fed-batch cultivation for higher cell densities and product titers

    • Continuous cultivation for long-term production

  • Induction Strategy:

    • Optimal induction point: 4 hours after inoculation for IPTG-inducible systems

    • Inducer concentration: 0.5 mM IPTG provides optimal expression

    • Temperature shift: Some proteins benefit from reduced temperature after induction

  • Oxygen Transfer:

    • P. putida has high oxygen demand due to its efficient respiratory metabolism

    • Ensuring adequate dissolved oxygen levels (>20% saturation) is critical

    • Increasing agitation and aeration rates with increasing cell density

  • Scale-up Considerations:

    • Maintaining consistent mixing and oxygen transfer during scale-up

    • Monitoring and controlling foam formation

    • Heat removal becomes more critical at larger scales

What Recent Advances Have Been Made in Engineering P. putida as a Platform for Recombinant Protein Production?

Recent advances in P. putida engineering include:

  • Genome-Reduced Strains: Development of the EM42 strain with reduced genome has significantly improved heterologous protein production capacity. Integration of expression systems in this strain further enhances productivity by up to 2.1-fold compared to wild-type strains .

  • T7-Like Expression Systems: Construction and optimization of T7-like expression systems specifically for P. putida has provided approximately 3-fold higher expression levels compared to traditional systems .

  • Novel Secretion Systems: Development of a flagellar type III secretion system for efficient secretion of recombinant enzymes, such as lignin-depolymerising peroxidase, enabling extracellular catalysis .

  • Metabolic Engineering for Alternative Carbon Sources: Integration of pathways for utilizing sustainable carbon sources such as sucrose , acetate derived from CO2 fixation , and lignin .

  • Spatiotemporal Control of Mutation Rates: Development of systems for manipulating the mismatch repair system to create conditional mutators, enabling accelerated evolution of desired phenotypes in P. putida .

  • Enhanced Biosynthesis of Natural Products: Heterologous expression of complex biosynthetic pathways for valuable compounds including:

    • Rhamnolipids (up to 400 mg/L)

    • Polyhydroxyalkanoates (up to 38.1 wt% in fed-batch cultures)

    • Prodigiosin (up to 94 mg/L)

    • Various terpenoids, polyketides, and non-ribosomal peptides

  • Increased Tolerance to Metabolic Perturbations: Studies have shown P. putida demonstrates remarkable robustness to increased ATP hydrolysis and NADH oxidation rates, making it suitable for NADH-dependent biocatalysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.