Recombinant Pseudomonas putida Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
ubiB; PputW619_0452; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
full length protein
Species
Pseudomonas putida (strain W619)
Target Names
ubiB
Target Protein Sequence
MKLLAVRRLFRIQRVVIRYRLDDLLFDLPLPWWLRSLRLLMPWRWLPRTPSELSRGARLR LALQDLGPIFIKFGQLLSTRRDLLPTDIADELMLLQDRVPPFDPKQAVALIESQLGAKVG EVFSRFDVEPLASASVAQVHAARLKTGEEVVVKVVRPGLKPVIAQDLAWLFLIAKGAERA SADARRLHPVEIVGDYEKTIYDELDLLREAANASQLRRNFEGSELMYVPQVYWDLCRPKV LVMERIYGVPVTDMATLADQRTDMKLLAERGVEVFFTQVFRHSFFHADMHPGNIFVSTVK PWSPQYIAIDCGIVGSLTAEDQDYLARNLIAFFKRDYRRVAELHIDSGWVPAHTKVNEFE AAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGRQLY PDLDLWSTAKPFLERWMRERYSPKAMFGNLYSQAEQLPHLAGMTRDLLERLSQPHLHDPQ LPERRRQGDRWALRLLGAGLLGGGAVLAASAAEAASLAAPAAWPAWLMLAAGLYLIVRQ
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What methodologies are most effective for recombineering in Pseudomonas putida?

Recombineering in P. putida has evolved significantly with the development of enhanced tools like ReScribe, which combines multiplex recombineering with CRISPR-Cas9-mediated counterselection. When working with genes like ubiB, the traditional Rec2-mediated recombineering approach requires approximately 6 working days per mutation with an average efficiency of only 8.3 ± 2.8% . In contrast, the single-targeting ReScribe method has demonstrated a substantial improvement in both time efficiency (reduced to 3 days per mutation) and recombination efficiency (increased to 90.5 ± 9.9%) .

For researchers beginning work with P. putida, it's important to note that contrary to findings in E. coli, oligonucleotides with phosphorothioate bonds do not result in higher recombineering efficiency in P. putida . Therefore, standard oligonucleotides without these modifications should be used in experimental designs focusing on ubiB or other genetic targets in this organism.

What experimental controls should be included when modifying the ubiB gene in Pseudomonas putida?

When designing experiments to modify the ubiB gene in P. putida, proper controls are essential for valid interpretation of results. Implementing a proper experimental design is crucial - as Campbell and Stanley emphasize, "Basic to scientific evidence is the process of comparison, of recording differences, or of contrast" .

For recombineering experiments targeting ubiB, the following control structure is recommended:

Control TypePurposeImplementation
Negative ControlEstablish baseline recombination ratesWild-type P. putida without recombineering plasmids
Plasmid-only ControlDetermine effects of plasmid burdenP. putida with recombineering plasmids but no targeting oligonucleotides
Non-targeting sgRNA ControlAssess CRISPR system effectsComplete ReScribe system with non-targeting sgRNA
Positive ControlValidate system functionalityTarget known high-efficiency locus (e.g., rpsL K43T)
Technical ReplicatesAccount for experimental variationMinimum three independent transformations
Biological ReplicatesAccount for strain variationRepeat with different P. putida isolates

This comprehensive control scheme addresses both the internal and external validity threats outlined in experimental design literature . One-shot case studies lacking such controls have "such a total absence of control as to be of almost no scientific value" .

How can successful modification of the ubiB gene be verified?

For verification of TAG codon recoding in ubiB, researchers should implement:

  • Sanger sequencing of the modified region

  • Whole-genome sequencing to detect any off-target modifications

  • Phenotypic assays to confirm ubiquinone biosynthesis pathway functionality

  • Growth assays under conditions that rely on respiratory chain function

Researchers should be aware that high plasmid burden can occur with the different targeting pSEVAb62-ScCas9_crRNA_(spacer) plasmids used in the ReScribe method. Fortunately, this facilitates easy isolation of plasmid-cured colonies, with an efficiency of 100% reported within 24 hours after two rounds of antibiotic-pressure-free media passaging .

What statistical approaches should be used to assess inconsistency in recombineering efficiency data for ubiB modifications?

When analyzing recombineering efficiency data for ubiB modifications, researchers must address potential inconsistency between experimental replicates and across different studies. Meta-analysis approaches can be valuable here, with the I² statistic serving as a key measure of inconsistency among studies .

For binary outcome data (such as successful/unsuccessful recombineering events), log odds ratios are recommended for statistical analysis, with empirical evidence showing that inconsistency among studies using this measure has a median I² of 22% (95% CI: 12% to 39%) in general research settings . For continuous outcome measures (such as growth rates of modified strains), standardized mean differences show higher inconsistency with median I² of 40% (95% CI: 15% to 73%) .

When designing experiments to measure recombineering efficiency for ubiB modification, researchers should:

  • Pre-specify the primary outcome measure and effect size of interest

  • Calculate adequate sample sizes based on expected variance

  • Consider hierarchical modeling approaches to account for between-study heterogeneity

  • Report all outcome measures with appropriate confidence intervals

These approaches allow for more robust interpretation of experimental data, especially when comparing different recombineering methods for modifying ubiB.

How can multiplex recombineering be optimized for simultaneous modification of ubiB and other ubiquinone biosynthesis genes?

Multiplex recombineering offers significant advantages for systems-level studies of ubiquinone biosynthesis in P. putida. The ReScribe method has been successfully employed for simultaneous recoding of multiple genes, though researchers should be aware of optimization requirements specific to ubiB.

When targeting ubiB alongside other genes in the ubiquinone biosynthesis pathway, researchers should consider the following optimization strategies:

  • Oligonucleotide concentration balancing: Adjust individual oligonucleotide concentrations based on their recombination efficiency to achieve more uniform editing

  • sgRNA design optimization: Design sgRNAs with minimal off-target effects using the PAM 5′-NNG-3′ of the CRISPR-Cas9 system

  • Temporal control of expression: Regulate the timing of Rec2-MutL expression and Cas9 activity to maximize recombination while minimizing toxicity

  • Metabolic burden management: Consider the metabolic impact of modifying ubiquinone biosynthesis genes and implement appropriate selective pressures

The efficiency of multiplex editing appears to be influenced by the specific genes targeted. While single-targeting ReScribe for ubiB demonstrated high efficiency (90.5 ± 9.9%) , this may decrease in multiplex editing scenarios. Researchers should conduct preliminary experiments to establish baseline efficiencies for their specific gene combinations.

What is the recommended protocol for recoding TAG codons in the ubiB gene using ReScribe?

The ReScribe method has proven highly effective for recoding TAG codons in P. putida genes including ubiB. Based on published methodologies, the following protocol is recommended:

Day 1: Preparation

  • Design and synthesize recombineering oligonucleotides (70-100 nt) targeting the TAG codon in ubiB, replacing it with TAA or TGA

  • Design sgRNA targeting the original TAG sequence (not the recoded version)

  • Transform P. putida with pSEVAb32-rec2-mutLE36KPP plasmid

  • Grow transformants in selective media

Day 2: Induction and Transformation

  • Induce expression of the recombineering machinery with 3-methylbenzoate

  • Prepare electrocompetent cells

  • Transform with the recombineering oligonucleotide and pSEVAb62-ScCas9_crRNA_(ubiB-TAG) plasmid

  • Recover and plate on selective media

Day 3: Screening

  • Screen colonies by colony PCR and restriction digestion

  • Confirm positive clones by sequencing

  • Initiate plasmid curing by growing in antibiotic-free media

Day 4: Plasmid Curing

  • Continue plasmid curing process

  • Confirm plasmid loss by testing for antibiotic sensitivity

This streamlined protocol leverages the high efficiency of the ReScribe method (90.5 ± 9.9%) to achieve ubiB modification in approximately half the time required by traditional recombineering approaches.

How can researchers analyze the impact of ubiB modification on ubiquinone biosynthesis in Pseudomonas putida?

Analyzing the impact of ubiB modification on ubiquinone biosynthesis requires a combination of analytical techniques:

Quantitative Analysis of Ubiquinone Content:

  • Extract quinones using a modified Bligh-Dyer method with acidified methanol

  • Separate ubiquinone species by HPLC with a C18 reverse-phase column

  • Quantify using UV detection at 275 nm or electrochemical detection

  • Compare ubiquinone content between wild-type and ubiB-modified strains

Metabolic Flux Analysis:

  • Culture cells with 13C-labeled glucose

  • Extract metabolites at different time points

  • Analyze isotopologue distribution by LC-MS/MS

  • Calculate flux through the ubiquinone biosynthesis pathway

Respiratory Chain Function Assessment:

  • Measure oxygen consumption rates using a Clark-type electrode

  • Determine sensitivity to respiratory inhibitors

  • Assess membrane potential using fluorescent probes

  • Compare ATP production rates between wild-type and modified strains

This multi-faceted approach provides comprehensive insights into how ubiB modification affects not only ubiquinone biosynthesis but also broader cellular energetics in P. putida.

How should researchers interpret contradictory results when studying ubiB function in Pseudomonas putida?

Contradictory results are common in biological research, particularly when investigating complex systems like ubiquinone biosynthesis. When faced with conflicting data regarding ubiB function, researchers should implement structured analysis approaches.

Meta-analytic techniques provide valuable frameworks for resolving contradictions. Studies examining inconsistency among research findings have established expected inconsistency levels (I² statistics) for different research designs , offering benchmarks against which to evaluate observed discrepancies.

For resolving contradictory results specific to ubiB function, consider:

  • Systematic assessment of methodological differences:

    • Compare growth conditions, strain backgrounds, and measurement techniques

    • Evaluate genetic context effects (e.g., polar effects on adjacent genes)

    • Consider post-translational regulatory differences

  • Statistical reconciliation approaches:

    • Implement random-effects meta-analysis for quantitative outcomes

    • Conduct sensitivity analyses by systematically excluding potential outliers

    • Apply Bayesian hierarchical modeling with informative priors based on biochemical constraints

  • Targeted validation experiments:

    • Design experiments specifically addressing points of contradiction

    • Include positive and negative controls addressing alternative hypotheses

    • Consider epistasis analyses with other ubiquinone biosynthesis genes

Remember that in scientific research, contradictions often highlight interesting biological complexities rather than experimental failures. As Campbell and Stanley note, "Securing scientific evidence involves making at least one comparison" , and contradictions can indicate that important comparison conditions have been overlooked.

What statistical methods are most appropriate for analyzing recombineering efficiency data in ubiB modification experiments?

The appropriate statistical methods for analyzing recombineering efficiency depend on the specific experimental design and outcome measures. For typical ubiB modification experiments using the ReScribe method, the following statistical approaches are recommended:

For Binary Outcomes (Success/Failure of Recombineering):

  • Calculate exact binomial confidence intervals for proportion of successful edits

  • Use logistic regression to assess factors affecting success rates

  • Apply chi-square or Fisher's exact tests for comparing different methodological approaches

For Continuous Outcomes (e.g., Growth Rates of Modified Strains):

  • Use t-tests or ANOVA for comparing groups, after confirming normality

  • Implement non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) if distributions are non-normal

  • Consider mixed-effects models for repeated measures designs

For meta-analyses comparing results across studies, researchers should be aware that inconsistency estimates are typically higher for continuous outcome meta-analyses compared to binary outcomes . This knowledge can inform the expected variability in experimental results and guide appropriate statistical power calculations.

When reporting results, always include measures of precision (confidence intervals) alongside point estimates, and consider the clinical or biological significance of findings, not just statistical significance.

What emerging technologies could advance research on ubiB function in Pseudomonas putida?

Research on ubiB function in P. putida is poised to benefit from several emerging technologies that extend beyond current recombineering and CRISPR-Cas9 approaches. Future research should consider:

  • Base editing technologies that enable precise nucleotide substitutions without double-strand breaks or donor DNA, potentially increasing efficiency beyond the 90.5 ± 9.9% achieved with ReScribe

  • Cell-free expression systems for rapid characterization of UbiB variants, bypassing the need for time-consuming genetic modifications

  • Single-cell analyses to investigate population heterogeneity in ubiquinone biosynthesis and identify potential compensatory mechanisms in ubiB-modified strains

  • Synthetic genomics approaches expanding on the minimal recoding strategies already applied to ubiB , potentially leading to synthetic P. putida strains with completely redesigned ubiquinone biosynthesis pathways

These emerging technologies will likely enable more comprehensive understanding of UbiB's role in ubiquinone biosynthesis and its broader implications for cellular energetics in P. putida.

How might systems biology approaches enhance our understanding of ubiB's role in Pseudomonas putida metabolism?

Systems biology approaches offer powerful frameworks for contextualizing ubiB function within the broader metabolic network of P. putida. These approaches could include:

By implementing these systems-level approaches, researchers can move beyond understanding ubiB as an isolated gene and develop a more holistic view of its role in P. putida physiology and metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.