Recombinant Pseudomonas putida Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Fundamental Function

Prolipoprotein diacylglyceryl transferase (lgt) is a membrane-bound enzyme that catalyzes the first critical step in bacterial lipoprotein biogenesis. This enzyme functions by transferring an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the thiol group of a conserved cysteine residue in bacterial preprolipoproteins, forming a thioether bond . The reaction represents the initial modification in a multi-step process that ultimately results in the anchoring of lipoproteins to bacterial membranes. The critical nature of this enzymatic reaction is evidenced by the fact that even modest depletion of lgt activity leads to significant loss of bacterial viability in various species .

Role in Bacterial Lipoprotein Processing Pathway

Lipoprotein biosynthesis in Gram-negative bacteria involves a sequential three-enzyme process that occurs at the inner membrane. All preprolipoproteins possess a signal peptide followed by a conserved four-amino-acid lipobox sequence ([LVI][ASTVI][GAS]C) that serves as the recognition motif for the modification machinery . Following secretion of preprolipoproteins through the membrane via the Sec or Tat pathways, lgt attaches the diacylglyceryl moiety to the thiol group of the conserved cysteine. Subsequently, prolipoprotein signal peptidase (LspA) cleaves the signal peptide, and lipoprotein N-acyltransferase (Lnt) adds a third fatty acid to the α-amino group of the modified cysteine . This coordinated process is essential for proper lipoprotein localization and function.

Evolutionary Conservation and Bacterial Survival

Lgt enzymes are highly conserved across bacterial species, underscoring their fundamental importance to bacterial physiology. Comparative analysis reveals that while specific amino acid sequences may vary between species, the enzyme's core functional domains remain remarkably preserved, particularly the so-called "Lgt signature motif" which contains four invariant residues . The evolutionary conservation of lgt reflects its indispensable role in bacterial survival, as demonstrated through depletion studies that consistently show impaired growth, compromised membrane integrity, and increased sensitivity to environmental stressors when lgt function is diminished .

Comparative Analysis with Other Bacterial lgt Enzymes

The P. putida lgt shares significant sequence homology with lgt enzymes from other Gram-negative bacteria, notably E. coli and Pseudomonas aeruginosa. Studies have shown that the P. aeruginosa lgt exhibits approximately 51.6% sequence identity with E. coli lgt . This level of conservation suggests that P. putida lgt likely possesses similar structural features and catalytic mechanisms. The conserved regions predominantly include the catalytic core and the signature motif that characterizes all lgt enzymes. Despite these similarities, species-specific variations in non-catalytic regions may contribute to differences in substrate specificity or regulatory mechanisms.

Catalytic Mechanism and Reaction Chemistry

The catalytic mechanism of lgt involves the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine residue in the lipobox of preprolipoproteins. This transfer results in the formation of a thioether bond and the release of glycerol phosphate as a byproduct . The reaction is highly specific, recognizing the characteristic lipobox sequence ([LVI][ASTVI][GAS]C) present in all preprolipoproteins. The catalytic activity of lgt can be monitored by measuring the release of glycerol phosphate or by detecting the addition of a 552 Da moiety (corresponding to the diacylglyceryl group) to substrate peptides using mass spectrometry .

Substrate Specificity and Recognition

Lgt demonstrates remarkable specificity for its substrates, requiring both a properly structured phosphatidylglycerol donor and a peptide substrate containing the lipobox motif. In experimental settings, synthetic peptides derived from natural lipoproteins, such as the Pal lipoprotein (Pal-IAAC), have been used to study lgt activity . The enzyme specifically recognizes the thiol group of the conserved cysteine within this motif. This high degree of substrate specificity is critical for ensuring that only appropriate proteins undergo lipid modification, thereby maintaining the integrity of bacterial membrane systems.

Expression Systems and Protein Production

Recombinant P. putida lgt can be produced using various expression systems, although the specific details for optimal expression conditions are not extensively documented in the provided literature. Based on general recombinant protein production practices and information available for related proteins, bacterial expression systems such as E. coli are commonly employed for the production of membrane proteins like lgt. The recombinant production typically involves cloning the lgt gene into an expression vector with an appropriate promoter and tag system for purification .

Purification Strategies and Challenges

The purification of recombinant P. putida lgt presents significant challenges due to its membrane-embedded nature. Membrane proteins require specialized extraction and purification protocols involving detergents or other membrane-mimetic systems to maintain protein stability and functionality. The commercial availability of purified recombinant P. putida lgt (typically supplied in Tris-based buffer with 50% glycerol) suggests that effective purification protocols have been established . These likely involve affinity chromatography using tags incorporated during the recombinant expression process, followed by additional purification steps to achieve high purity.

Potential as an Antibiotic Target

One of the most promising applications for research on P. putida lgt lies in its potential as an antibiotic target. Studies on related bacterial species have demonstrated that even modest depletion of lgt leads to significant impairment of bacterial viability, disruption of membrane integrity, and increased sensitivity to antibiotics that are normally excluded by the Gram-negative outer membrane . Unlike other lipoprotein processing enzymes, resistance to lgt inhibition cannot be achieved through deletion of major lipoproteins such as Lpp, making it a particularly attractive therapeutic target . This characteristic suggests that inhibitors targeting lgt could represent a novel class of antibiotics with potentially broad-spectrum activity against Gram-negative pathogens.

Biotechnological Applications in Pseudomonas putida Systems

P. putida has gained significant attention as a robust host for heterologous gene expression and metabolite production due to its metabolic versatility and stress resistance . While not directly focused on lgt, research has demonstrated the successful use of P. putida KT2440 as a host for heterologous secondary metabolite biosynthesis using systems like the yeast recombinational cloning-enabled pathway transfer and expression tool (yTREX) . Understanding P. putida lgt and lipoprotein processing machinery could potentially enhance these biotechnological applications by improving membrane protein expression systems or developing novel protein display technologies based on lipoprotein anchoring mechanisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
lgt; Pput_5049; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)
Target Names
lgt
Target Protein Sequence
MLPYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWLLASRRLNRFDPTWSREKLSDLVFWL SMGVIVGGRLGYVLFYDLHAYLANPTLIFEVWKGGMSFHGGFIGVMLAALWFGKRNNKSF FELMDFVAPLVPIGLGAGRIGNFINAELWGKPTDVPWAMIFPPFSDPAQLPRHPSQLYQF ALEGVALFVILWLFSRKPRPTMAVSGMFALFYGIFRFIVEFVRVPDAQLGYIAWGWLTMG QILCVPMILAGLGLIWWAYNRKPTAKPA
Uniprot No.

Target Background

Function

Function: This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is prolipoprotein diacylglyceryl transferase (Lgt) and what is its role in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme that catalyzes the first step in bacterial lipoprotein biogenesis. It specifically transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox motif of prolipoprotein substrates, forming a thioether bond. This modification is essential for the proper localization and function of bacterial lipoproteins, which play crucial roles in bacterial growth, cell envelope integrity, and pathogenesis. The enzyme's activity results in the release of glycerol phosphate as a byproduct of the reaction, which can be measured to assess enzymatic activity in laboratory settings .

Lgt is conserved across diverse bacterial species, though with varying sequence identity. For instance, Staphylococcus aureus Lgt shows 24% identity and 47% similarity with Escherichia coli, Salmonella typhimurium, and Haemophilus influenzae counterparts, while maintaining similar hydropathic profiles and predicted isoelectric points . Multiple sequence alignment of Lgt proteins from these species has identified regions of highly conserved amino acid sequences, with the sequence H-103-GGLIG-108 being identical across these microorganisms, suggesting functional importance .

Why is Pseudomonas putida an attractive host for recombinant protein expression?

Pseudomonas putida has emerged as an excellent microbial chassis for recombinant protein expression due to several advantageous characteristics:

  • Well-established genetic manipulation tools and cultivation techniques are available, making it accessible for laboratory work .

  • It possesses a versatile intrinsic metabolism with diverse enzymatic capacities, providing a rich biochemical background for heterologous protein production .

  • P. putida exhibits exceptional tolerance to xenobiotics and antibiotics, allowing for robust growth even in challenging environments or when producing potentially toxic recombinant proteins .

  • The KT2440 strain has GRAS (Generally Recognized as Safe) certification, facilitating its use in various laboratory settings without special containment requirements .

  • It offers a relatively "clean" metabolic background that simplifies the detection of many heterologously synthesized metabolites .

  • The bacterium's high GC content makes it suitable for expression of genes from GC-rich bacterial clades like actinobacteria or myxobacteria .

  • It possesses effective efflux systems that can be beneficial when producing certain compounds .

These characteristics have made P. putida a successful platform for the production of various natural products, including rhamnolipids, terpenoids, polyketides, and non-ribosomal peptides .

What expression systems are available for recombinant Lgt production in P. putida?

Several inducible promoter systems are available for controlled gene expression in P. putida, including:

Native promoter systems:

  • Pm/XylS system (induced by m-toluate)

  • PsaI/NahR system (induced by salicylate)

  • PalkB/AlkS system (induced by short-chain alkanes)

Non-native systems:

  • Plac/LacI system (induced by IPTG)

These systems provide researchers with flexibility in controlling the expression timing and level of recombinant proteins, including Lgt . The choice of expression system depends on specific experimental requirements, such as the desired expression level, induction timing, and potential toxicity of the recombinant protein.

Table 1: Comparison of Expression Systems for Recombinant Protein Production in P. putida

Promoter SystemInducerNative/Non-nativeExpression CharacteristicsApplications
Pm/XylSm-toluateNativeTight regulation, dose-dependentGeneral recombinant protein expression
PsaI/NahRSalicylateNativeStrong inductionHigh-level protein production
PalkB/AlkSShort-chain alkanesNativeModerate expressionExpression of membrane proteins
Plac/LacIIPTGNon-nativeWell-characterized, tunableLaboratory-scale expression

How is recombinant Lgt activity measured in laboratory settings?

The enzymatic activity of recombinant Lgt can be measured using various biochemical assays. One established method involves monitoring the release of glycerol phosphate, which is a byproduct of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate.

A specific methodology described in the literature uses:

  • A peptide substrate derived from the Pal lipoprotein (Pal-IAAC, where C is the conserved cysteine modified by Lgt)

  • Phosphatidylglycerol containing a racemic glycerol moiety at the end of the phosphatidyl group

  • A coupled luciferase reaction for detection of the released glycerol-3-phosphate (G3P)

During the reaction, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released as Lgt catalyzes the transfer. The detection system specifically measures G3P through a coupled enzymatic reaction that ultimately produces a luminescent signal proportional to Lgt activity .

To validate assay specificity, control experiments can be performed using a mutant Pal peptide substrate with the conserved cysteine mutated to alanine (Pal-IAA), which would not be recognized as a substrate by Lgt .

What structural features and conserved motifs are critical for recombinant Lgt function?

Comparative analysis of Lgt proteins from phylogenetically distant bacterial species has revealed important structural features essential for enzymatic function. Studies of E. coli, S. typhimurium, H. influenzae, and S. aureus Lgt proteins identified regions of highly conserved amino acid sequences throughout the molecule, suggesting their functional importance .

The most conserved region without any sequence gaps is the H-103-GGLIG-108 motif in E. coli Lgt. The critical nature of this motif is highlighted by temperature-sensitive mutants: in E. coli lgt mutant SK634, a single point mutation changing Gly-104 to Ser in this region resulted in temperature sensitivity and significantly reduced LGT activity in vitro .

Chemical modification studies using diethylpyrocarbonate have demonstrated that histidine or tyrosine residues are essential for Lgt activity. Diethylpyrocarbonate inactivated E. coli Lgt with a second-order rate constant of 18.6 M⁻¹s⁻¹, and this inactivation was reversed by hydroxylamine treatment at pH 7. The inactivation kinetics were consistent with the modification of a single residue essential for activity .

When designing recombinant Lgt constructs for heterologous expression in P. putida, researchers should ensure these conserved motifs remain intact to maintain enzyme functionality.

What are the challenges in expressing functional membrane-associated Lgt in P. putida?

Expressing functional Lgt in P. putida presents several challenges due to its nature as a membrane-associated enzyme:

  • Membrane integration: Lgt is a membrane protein that must be correctly integrated into the bacterial membrane to function properly. Ensuring proper targeting and insertion in the recombinant host can be challenging.

  • Protein folding: The hydropathic profile of Lgt is critical for its function. For example, S. aureus Lgt, while 12 amino acids shorter than the E. coli enzyme, maintains a similar hydropathic profile and predicted pI (10.4) . Maintaining proper folding in a heterologous host requires optimization of expression conditions.

  • Substrate availability: Lgt requires phosphatidylglycerol as a substrate. The fatty acid composition of membrane phospholipids in P. putida differs from other bacteria, potentially affecting substrate recognition and enzyme activity.

  • Detergent selection for purification: If purification of the recombinant Lgt is required, selection of appropriate detergents is crucial. As demonstrated in affinity selection studies with E. coli Lgt, n-dodecyl β-D-maltoside (DDM) at 0.02% concentration has been successfully used to maintain Lgt in a functional state .

  • Protein toxicity: Overexpression of membrane proteins can be toxic to the host cell. P. putida's tolerance to xenobiotics may provide an advantage here, but expression levels still need to be carefully controlled.

How can inhibitor screening be performed using recombinant Lgt from P. putida?

Inhibitor screening against recombinant Lgt can provide valuable tools for antibiotic development. A systematic approach for inhibitor screening would include:

  • Biochemical assay setup: Implement the glycerol phosphate release assay as described earlier to measure Lgt activity in the presence of potential inhibitors .

  • Primary screening: Test compounds at a fixed concentration (e.g., 10 μM) and identify those that significantly inhibit Lgt activity.

  • Dose-response curves: Determine IC₅₀ values for promising compounds by testing them at varying concentrations. Examples from the literature show potent inhibitors with IC₅₀ values of 0.18-0.93 μM .

  • Specificity controls: Use mutant substrates (e.g., Pal-IAA instead of Pal-IAAC) to confirm that inhibition is specific to the Lgt-catalyzed reaction .

  • Whole-cell validation: Test inhibitors against bacterial strains to determine their bactericidal activity. This helps validate that the compounds can access the target in intact cells and exert antimicrobial effects .

  • Genetic validation: Use Lgt-depleted strains to confirm that the phenotypic effects of the inhibitors match those of genetic Lgt depletion. This helps confirm on-target activity .

  • Resistance studies: Attempt to generate resistance to the inhibitors. The inability to generate on-target resistant mutants may indicate that the inhibitors bind to highly conserved active sites essential for Lgt function .

Table 2: Example Data from Lgt Inhibitor Screening

Compound IDIC₅₀ (μM)Bactericidal against wild-type strainsMechanism of action
G90660.24YesInhibition of Lgt biochemical activity
G28230.93YesInhibition of Lgt biochemical activity
G28240.18YesInhibition of Lgt biochemical activity

What approaches can be used to optimize recombinant Lgt expression in P. putida?

Optimizing recombinant Lgt expression in P. putida requires a multifaceted approach:

  • Genetic optimization:

    • Codon optimization based on P. putida's codon usage preferences

    • Use of strong, inducible promoters such as Pm/XylS or PsaI/NahR systems

    • Incorporation of efficient ribosome binding sites

    • Addition of appropriate fusion tags to enhance expression or solubility

  • Process engineering optimization:

    • Temperature control during expression (typically lower temperatures for membrane proteins)

    • Optimization of induction timing and inducer concentration

    • Media composition adjustments to support membrane protein production

    • Fed-batch cultivation strategies to achieve high cell densities

  • Strain engineering:

    • Use of P. putida strains with enhanced protein expression capabilities

    • Deletion of competing metabolic pathways to channel resources toward recombinant protein production

    • Modification of membrane composition to better accommodate the recombinant membrane protein

  • Integration of genetic and process engineering:
    As demonstrated with other recombinant proteins in P. putida, an integrated approach combining genetic modifications with bioprocess optimization can significantly improve yields .

How can recombinant Lgt from P. putida be used for structural studies?

Structural studies of recombinant Lgt require careful preparation of the protein while maintaining its native conformation:

  • Protein purification strategy:

    • Affinity purification using tags (His-tag, biotin-tag) as demonstrated in the literature for E. coli Lgt

    • Membrane extraction using appropriate detergents (0.02% n-dodecyl β-D-maltoside has been shown to work)

    • Size exclusion chromatography to ensure protein homogeneity

    • Concentration of purified protein to levels suitable for structural studies

  • Structural determination methods:

    • X-ray crystallography: Requires growing crystals of purified Lgt, which can be challenging for membrane proteins

    • Cryo-electron microscopy: Increasingly popular for membrane protein structural studies

    • NMR spectroscopy: Suitable for studying protein dynamics and ligand interactions

  • Structure-function studies:

    • Site-directed mutagenesis of conserved residues (such as those in the H-103-GGLIG-108 motif) to determine their roles

    • Comparative studies with Lgt from different bacterial species to identify structural determinants of substrate specificity

    • Co-crystallization with substrates or inhibitors to elucidate the catalytic mechanism

  • Use of recombinant Lgt for antibody development:

    • Generation of antibodies against purified recombinant Lgt for immunolocalization studies

    • Development of antibody-based detection systems for Lgt in various bacterial species

What methods exist for affinity selection of ligands binding to recombinant Lgt?

Advanced methods for affinity selection of ligands binding to recombinant Lgt have been described in the literature:

  • Macrocyclic peptide selection:

    • Affinity selection of macrocyclic peptides binding to Lgt can be performed using biotinylated Lgt in detergent solutions

    • The process involves creating an mRNA library hybridized with a peptide-linker and translating it in vitro to generate a peptide-mRNA fusion library

    • The peptide-mRNA/cDNA solution is incubated with biotinylated Lgt, followed by capture with streptavidin-coated beads

    • After washing to remove non-binders, bound cDNA is eluted and analyzed by quantitative PCR

    • Multiple rounds of selection with increasing stringency can identify high-affinity binders

    • Final enriched cDNA is sequenced using next-generation sequencing technologies

  • In silico screening followed by experimental validation:

    • Computational docking of virtual compound libraries against the Lgt structure

    • Selection of promising candidates for experimental testing

    • Biochemical validation using the glycerol phosphate release assay described earlier

  • Fragment-based screening:

    • Testing small molecular fragments for binding to Lgt

    • Growing or linking fragments to develop more potent ligands

    • NMR or X-ray crystallography to confirm binding modes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.