Recombinant Pseudomonas putida Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
crcB; PputW619_2862; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Pseudomonas putida (strain W619)
Target Names
crcB
Target Protein Sequence
MLKSLLAIGLGAMVGAWLRWGLGMKLNALFPAVPPGTLLANLIGGYIIGLAIAFFSASPS LSPEWRLLLITGFCGGLTTFSTFSAEVVSLIQEGRILWALGSIALHVSGSLLMTAAGLAT FYFISGR
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CrcB protein in Pseudomonas putida and what is its primary function?

CrcB in Pseudomonas putida functions as a fluoride ion transporter that exports fluoride ions (F-) from the cytoplasm, thus protecting cellular processes from fluoride toxicity. This protein is a critical component of the bacterial defense mechanism against environmental fluoride. In P. putida KT2440, CrcB enables the organism to tolerate remarkably high concentrations of sodium fluoride (up to 75 mM NaF), though with reduced growth at these elevated concentrations . The protein allows the bacterium to maintain low intracellular fluoride levels even when external concentrations are significant.

The molecular mechanism involves CrcB forming transmembrane channels that selectively transport fluoride ions out of the cell, preventing their accumulation to toxic levels within the cytoplasm. This export function is essential because intracellular fluoride can inhibit various enzymes, particularly those that process phosphoryl group transfer.

How conserved is the CrcB protein across Pseudomonas species?

The CrcB protein demonstrates remarkable conservation across the Pseudomonas genus. Analysis of sequence homology reveals that CrcB is highly conserved among many Pseudomonas species, suggesting its fundamental importance to the genus . Specifically, the CrcB protein in P. putida ATCC 12633 shares 98% sequence identity with the CrcB in P. putida KT2440, and the genomic regions surrounding the gene are identical between these strains .

This high degree of conservation indicates strong evolutionary pressure to maintain CrcB function, suggesting that fluoride resistance is an important adaptive trait across the Pseudomonas genus. The conservation pattern further suggests that Pseudomonas species generally possess robust mechanisms to handle relatively high concentrations of environmental fluoride.

What phenotypic changes occur when the crcB gene is deleted in P. putida?

Deletion of the crcB gene in P. putida results in dramatic phenotypic changes related to fluoride sensitivity:

ParameterWild-type P. putida KT2440P. putida ΔcrcB mutant
Maximum tolerable NaF concentration75 mM0.5 mM
Growth in 0.5 mM NaFNormalCompletely inhibited
Response pattern to increasing NaFDecreasing asymptotic growthAbrupt growth suppression

The ΔcrcB mutant exhibits extreme sensitivity to fluoride, with growth completely inhibited at concentrations above 0.5 mM NaF, compared to the wild-type strain that can tolerate up to 75 mM NaF (albeit with reduced growth) . This striking difference demonstrates the essential role of CrcB in fluoride detoxification.

Additionally, morphological changes have been observed in P. putida under fluoride stress, including cell shortening, which had not been previously reported specifically in response to fluoride but has been observed in Pseudomonas syringae under starvation stress conditions .

How can CrcB be used in the development of fluoride-responsive genetic circuits?

The CrcB protein and its regulatory system can be leveraged to develop sophisticated fluoride-responsive genetic circuits in P. putida. A key application involves using the fluoride sensitivity of the ΔcrcB mutant combined with fluoride-responsive genetic elements to create biosensors and conditional gene expression systems.

Researchers have implemented a dual system in P. putida ΔcrcB strains that responds to very small changes in external NaF concentration. This system combines:

  • A fluoride-responsive sensor (FRS) controlling the expression of T7 RNA polymerase (FRS-T7RNAP)

  • A T7 promoter driving the expression of a reporter gene (e.g., msfGFP)

This engineered P. putida ΔcrcB::FRS-T7RNAP strain carrying a plasmid with P→T7 msfGFP responds to minimal changes in external fluoride concentration, making it an extremely sensitive biosensor for fluoride . The system can be adapted for various applications by replacing the reporter gene with other genes of interest.

Additionally, this fluoride-responsive genetic circuit has been implemented for in vivo biofluorination in P. putida, demonstrating its utility beyond simple sensing applications .

What are the optimal conditions for expressing recombinant CrcB in heterologous systems?

Expressing recombinant CrcB requires careful consideration of several factors to ensure proper folding, membrane insertion, and function. Although the search results don't provide specific details for CrcB expression, general methodological approaches for membrane protein expression can be applied:

For heterologous expression in E. coli systems:

  • Use of low temperature (28°C) induction to slow protein synthesis and improve folding

  • IPTG concentrations around 0.5-1.0 mM for controlled induction

  • Use of specialized E. coli strains designed for membrane protein expression

  • Inclusion of mild detergents during cell lysis to solubilize membrane proteins

For native expression in Pseudomonas:

  • Genomic integration using mini-Tn5 transposon-based systems, similar to approaches used for other Pseudomonas proteins

  • Use of native promoters to maintain physiological expression levels

  • Growth in minimal media with controlled fluoride levels to assess functionality

It's worth noting that overexpression of membrane transporters can sometimes be toxic to cells, so titration of expression levels may be necessary when working with recombinant CrcB.

How does CrcB contribute to fluoride tolerance in P. putida compared to other bacterial species?

Pseudomonas putida exhibits unusually high fluoride tolerance compared to many other bacterial species, with the CrcB protein playing a central role in this adaptation. While many bacteria possess CrcB homologs, the efficiency and capacity of the P. putida CrcB appears exceptional:

Bacterial SpeciesFluoride ToleranceCrcB Contribution
P. putida KT2440Up to 75 mM NaFCritical for survival above 0.5 mM
P. putida ATCC 12633High (similar to KT2440)98% protein identity to KT2440 CrcB
Other Pseudomonas spp.Generally robustHighly conserved CrcB sequences
B. subtilisLower than PseudomonasContains CrcB homolog (YhdU)

The exceptional fluoride tolerance observed in P. putida suggests that either the CrcB protein itself has enhanced activity or that additional complementary mechanisms exist that work alongside CrcB to confer this heightened resistance .

The extreme sensitivity of the ΔcrcB mutant indicates that CrcB is the primary determinant of fluoride resistance in P. putida, rather than redundant systems. This contrasts with some other bacterial species where multiple fluoride resistance mechanisms may operate in parallel.

What experimental approaches can be used to study the structure-function relationship of CrcB?

Investigating the structure-function relationship of CrcB requires a multidisciplinary approach combining various molecular and biochemical techniques:

  • Site-Directed Mutagenesis: Similar to approaches used for studying other Pseudomonas proteins, researchers can target conserved residues in CrcB to identify those critical for:

    • Fluoride binding and selectivity

    • Channel formation

    • Transport kinetics

    • Protein stability

  • Protein Purification and Structural Analysis:

    • For membrane proteins like CrcB, purification typically involves:

      • Solubilization with appropriate detergents

      • Affinity chromatography (using His-tags as demonstrated for other Pseudomonas proteins)

      • Reconstitution into lipid vesicles for functional assays

    • Structural determination through:

      • X-ray crystallography (challenging for membrane proteins)

      • Cryo-electron microscopy

      • NMR spectroscopy for dynamics studies

  • Fluoride Transport Assays:

    • Liposome-based fluoride efflux assays using fluoride-sensitive dyes

    • Whole-cell assays comparing fluoride accumulation in wild-type versus mutant strains

    • Electrophysiological measurements of purified CrcB reconstituted in artificial membranes

  • In vivo Complementation Studies:

    • Expression of CrcB variants in ΔcrcB mutants to assess restoration of fluoride resistance

    • Cross-species complementation to evaluate functional conservation

The purification protocol might follow methods similar to those used for other Pseudomonas proteins, involving cell growth at moderate temperatures (28°C), protein expression induction with IPTG, cell disruption by sonication, and purification using Ni-NTA resin chromatography under appropriate conditions for membrane proteins .

How can CrcB be engineered to enhance fluoride export capabilities in recombinant P. putida strains?

Engineering enhanced CrcB functionality for improved fluoride export could employ several strategic approaches:

  • Promoter Engineering:

    • Replacing the native CrcB promoter with stronger, constitutive promoters

    • Developing tunable expression systems responsive to fluoride levels, creating a positive feedback loop where higher fluoride concentrations trigger increased CrcB expression

  • Protein Engineering:

    • Directed evolution approaches exposing P. putida to gradually increasing fluoride concentrations

    • Rational design based on structural insights from CrcB homologs in extremophile bacteria

    • Creation of CrcB fusion proteins with enhanced membrane localization signals

  • Multi-copy Integration:

    • Unlike some regulatory proteins where overexpression impairs function (as seen with Crc protein) , increasing CrcB copy number might enhance fluoride export capacity

    • Genomic integration of multiple CrcB copies at different loci using mini-Tn5 transposon systems

  • Metabolic Engineering:

    • Enhancing energy availability for this active transport process

    • Co-expression of molecular chaperones to improve CrcB folding and membrane insertion

When engineering CrcB, researchers should consider that extreme overexpression might cause membrane stress, potentially leading to growth defects unrelated to fluoride handling. Therefore, expression optimization should balance improved fluoride export against potential cellular toxicity.

What are the methodological considerations for using CrcB as a selection marker in synthetic biology applications?

Using CrcB as a selection marker in synthetic biology applications with P. putida offers a novel alternative to traditional antibiotic resistance markers, with several methodological considerations:

  • Selection System Design:

    • The stark difference in fluoride tolerance between wild-type (75 mM) and ΔcrcB (0.5 mM) strains provides a wide dynamic range for selection

    • Optimal NaF concentrations for selection would be 1-5 mM, which completely inhibit ΔcrcB mutants while allowing growth of CrcB-expressing strains

  • Vector Construction:

    • CrcB selection cassettes should include:

      • The complete crcB gene with its native promoter

      • Appropriate transcriptional terminators

      • Flanking homology regions for genomic integration

  • Experimental Workflow:

    • Two-step selection process:

      1. Initial transformation and selection on traditional markers

      2. Counter-selection on fluoride-containing media to identify successful CrcB expressors

  • Potential Limitations:

    • Background fluoride in media components may affect selection stringency

    • Spontaneous fluoride-resistant mutants might arise through alternative mechanisms

    • Cross-complementation from chromosomal genes in certain hosts

  • Validation Approaches:

    • PCR confirmation of crcB integration

    • Growth curve analysis in varying fluoride concentrations

    • Fluoride uptake/export assays

This selection system would be particularly valuable for environmental applications where antibiotic resistance markers are undesirable, offering an environmentally relevant selection pressure instead.

How does the CrcB protein interact with other cellular components during fluoride stress response?

Understanding the interactions between CrcB and other cellular components during fluoride stress requires investigation of the broader stress response network in P. putida:

  • Potential Protein-Protein Interactions:

    • CrcB may interact with other membrane proteins involved in ion homeostasis

    • Possible interactions with cytoskeletal elements, given the observation of cell shortening under fluoride stress

    • Potential recruitment of stress response proteins to the membrane

  • Transcriptional Response Network:

    • Global transcriptomic analysis comparing wild-type and ΔcrcB mutants exposed to sub-lethal fluoride concentrations

    • Investigation of potential transcription factors regulating crcB expression

    • Analysis of the relationship between carbon metabolism stress (where Crc protein functions) and fluoride stress responses

  • Metabolic Adaptations:

    • Changes in energy metabolism to support CrcB-mediated fluoride export

    • Potential metabolic rerouting to avoid fluoride-sensitive enzymatic steps

    • Adaptations in membrane composition to accommodate increased CrcB activity

  • Protective Mechanisms Beyond CrcB:

    • While CrcB is the primary fluoride resistance determinant, secondary mechanisms might include:

      • Changes in cell envelope permeability

      • Production of fluoride-binding molecules

      • Induction of general stress response elements

Of particular interest would be the relationship between fluoride stress and other environmental stresses. The cell shortening observed under fluoride stress in Pseudomonas has parallels with starvation stress responses in related species , suggesting possible overlap in stress response pathways.

What protocols are recommended for generating stable P. putida ΔcrcB mutants for research purposes?

Creating stable P. putida ΔcrcB mutants requires precise genetic manipulation techniques. Based on approaches used for similar genetic modifications in Pseudomonas:

  • Gene Deletion Strategy:

    • Homologous recombination using suicide vectors containing:

      • 500-1000 bp homology arms flanking the crcB gene

      • A selection marker (e.g., antibiotic resistance gene)

      • Counter-selection marker (e.g., sacB for sucrose sensitivity)

  • Step-by-Step Protocol:

    • Construct deletion vector with flanking regions but without the crcB coding sequence

    • Transform into E. coli strain maintaining suicide vectors (e.g., E. coli CC118(λpir))

    • Transfer to P. putida via triparental mating using helper plasmids like pRK600

    • Select first recombinants on appropriate antibiotic

    • Counter-select for second recombination event on sucrose-containing media

    • Screen resulting colonies for successful crcB deletion by PCR and sequencing

    • Confirm phenotype by testing growth on media with 1 mM NaF

  • Alternative CRISPR-Cas9 Approach:

    • Design sgRNA targeting crcB

    • Provide repair template with homology arms

    • Select transformants and screen for successful deletions

  • Validation Methods:

    • PCR verification of deletion

    • RT-qPCR to confirm absence of crcB transcript

    • Fluoride sensitivity assay (growth inhibition at 0.5-1 mM NaF)

    • Complementation test with wild-type crcB to restore fluoride resistance

This approach ensures complete gene deletion rather than disruption, avoiding potential issues with truncated proteins that might retain partial function.

How can fluoride-responsive genetic circuits utilizing CrcB be optimized for biosensor applications?

Optimizing fluoride-responsive genetic circuits based on CrcB for biosensor applications requires fine-tuning several key components:

  • Sensor Component Optimization:

    • Modification of the fluoride-responsive sensor (FRS) element to adjust sensitivity range

    • Testing various reporter proteins beyond msfGFP, such as:

      • Luciferases for higher sensitivity

      • Fluorescent proteins with different spectral properties

      • Enzymatic reporters for colorimetric detection

  • Circuit Architecture Refinement:

    • Incorporation of signal amplification loops

    • Implementation of threshold-based responses using cooperative transcription factors

    • Addition of feedback mechanisms to improve response linearity

  • Response Characteristics Tuning:

    • Adjusting the dynamic range for specific applications:

      ApplicationOptimal Detection RangeResponse Time
      Environmental monitoring0.1-10 mM F-<1 hour
      Bioprocess monitoring0.01-1 mM F-<10 minutes
      Research tools0.001-5 mM F-Tunable
  • Delivery System Development:

    • Immobilization of engineered cells in biosensor formats

    • Lyophilization protocols for long-term storage

    • Microfluidic integration for continuous monitoring

The existing data show that P. putida ΔcrcB::FRS-T7RNAP strains carrying reporter plasmids respond to very small changes in external fluoride concentration , making them excellent starting points for biosensor development. These systems could be optimized through iterative design-build-test cycles, systematically modifying components to achieve desired performance characteristics.

What are the key considerations for expressing functional CrcB in heterologous hosts beyond Pseudomonas?

Expressing functional CrcB in heterologous hosts beyond Pseudomonas presents several challenges that require specific methodological approaches:

  • Host Selection Considerations:

    • Membrane composition compatibility

    • Codon usage optimization

    • Availability of appropriate chaperones

    • Cellular tolerance to potential membrane disruption

  • Expression System Design:

    • For E. coli expression:

      • Use of specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression

      • Induction at reduced temperatures (16-28°C) to slow folding

      • Addition of membrane-stabilizing compounds to growth media

  • Functional Validation Methods:

    • Growth assays in fluoride-containing media

    • Fluoride uptake/export assays using fluoride-specific probes

    • Membrane localization confirmation via fractionation and Western blotting

    • Fluorescent tagging to visualize proper membrane insertion

  • Troubleshooting Approaches:

    • For inclusion body formation:

      • Reduce expression temperature further

      • Co-express molecular chaperones

      • Create fusion proteins with solubility-enhancing partners

    • For lack of function despite expression:

      • Verify proper membrane insertion

      • Ensure compatible lipid environment

      • Check for post-translational modifications

Based on experiences with other membrane proteins, purification methods might include cell disruption by sonication followed by membrane solubilization with appropriate detergents and purification using affinity tags like the His-tag system described for other Pseudomonas proteins .

What are the emerging applications of engineered CrcB variants in synthetic biology?

Engineered CrcB variants offer promising applications in various synthetic biology fields:

  • Bioremediation Systems:

    • Development of P. putida strains with enhanced CrcB activity for fluoride-contaminated water treatment

    • Creation of biofilms with high fluoride-sequestration capacity

    • Integration of CrcB-based circuits with other contaminant-processing pathways

  • Biosensing Platforms:

    • Multi-analyte environmental sensors using CrcB alongside other ion-specific transporters

    • Wearable biosensors for fluoride exposure monitoring

    • Field-deployable fluoride detection systems for resource-limited settings

  • Biocontainment Strategies:

    • Development of fluoride-dependent strains requiring specific environmental conditions

    • Creation of genetic safeguards using CrcB as part of kill-switch mechanisms

    • Conditional growth systems for industrial bioproduction

  • Metabolic Engineering Applications:

    • Protection of engineered metabolic pathways sensitive to fluoride inhibition

    • Development of fluoride-resistant chassis strains for industrial processes

    • Conditional pathway activation using fluoride-responsive elements

The fluoride-responsive genetic circuits already implemented in P. putida for organofluorine biosynthesis demonstrate the feasibility of using CrcB-based systems for sophisticated synthetic biology applications beyond simple fluoride resistance.

How might combining CrcB studies with other stress response systems provide insights into bacterial adaptation mechanisms?

Integrating CrcB research with broader stress response studies offers a systems biology perspective on bacterial adaptation:

  • Multi-stress Response Networks:

    • Investigation of overlap between fluoride stress responses and:

      • Oxidative stress pathways

      • Acid stress responses

      • Metal ion stress mechanisms

      • Carbon starvation responses (particularly interesting given the observed cell shortening similarities)

  • Evolutionary Adaptation Studies:

    • Comparative genomics across Pseudomonas species to identify co-evolved stress response elements

    • Experimental evolution under multiple stressors to identify adaptive pathway interactions

    • Analysis of horizontal gene transfer patterns for stress response elements

  • Integrated Stress Response Modeling:

    • Development of mathematical models integrating:

      • Ion transport dynamics

      • Gene regulatory networks

      • Metabolic adaptations

      • Growth rate modulation

  • Applied Research Opportunities:

    • Development of multi-resistant strains for challenging environments

    • Creation of biosensors detecting multiple environmental stressors

    • Identification of novel targets for antimicrobial development

The observation that fluoride stress induces cell shortening similar to starvation stress responses in Pseudomonas syringae suggests common downstream effects or signaling pathways between these seemingly distinct stressors, warranting further investigation into these potential connections.

What novel methodologies could advance structural studies of the CrcB protein?

Advancing structural understanding of CrcB requires innovative methodological approaches to overcome challenges inherent in membrane protein research:

  • Advanced Structural Biology Techniques:

    • Serial femtosecond crystallography at X-ray free-electron lasers (XFELs)

    • Single-particle cryo-electron microscopy optimized for small membrane proteins

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Solid-state NMR for membrane-embedded structural analysis

  • Computational Approaches:

    • Molecular dynamics simulations of CrcB in native-like membranes

    • AI-assisted structure prediction refined with experimental constraints

    • Quantum mechanical calculations of fluoride binding and transport

  • Innovative Expression Systems:

    • Cell-free membrane protein expression in lipid nanodiscs

    • Development of specialized Pseudomonas expression systems optimized for membrane protein production

    • Creation of chimeric constructs with well-behaved membrane protein domains

  • Functional Assays at Single-Molecule Resolution:

    • Single-molecule fluorescence resonance energy transfer (FRET) to track conformational changes

    • High-speed atomic force microscopy to visualize CrcB dynamics in membranes

    • Nanopore-based electrical recordings of individual CrcB channels

These methodologies would complement traditional approaches and potentially overcome barriers that have limited structural studies of fluoride channels. The resulting structural insights would inform rational engineering efforts to enhance CrcB function for various applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.