Recombinant Pseudomonas putida Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression and Isolation

  • Vector: Broad-host-range plasmids or transposon-based systems (e.g., Tn5) integrated into P. putida or E. coli .

  • Purification: Affinity chromatography via His tag, yielding >90% purity (SDS-PAGE) .

ParameterSpecification
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-80°C long-term; 4°C for working aliquots (≤1 week). Avoid freeze-thaw cycles.
ReconstitutionSterile water (0.1–1.0 mg/mL) with optional 50% glycerol for stability .

Functional Insights

Mechanistic Role

  • Sulfoxide Reduction: Catalyzes the reduction of methionine sulfoxide to methionine, critical for repairing oxidative damage to proteins .

  • Heme Binding: Facilitates electron transfer via a bound heme cofactor, linking sulfur metabolism to cellular redox balance .

Genomic Context

  • The yedZ gene is part of the msrQ operon, often expressed under constitutive promoters in optimized P. putida strains .

Applications in Research and Industry

Biotechnological Uses

  1. Oxidative Stress Studies: Used to investigate microbial responses to reactive oxygen species (ROS) .

  2. Enzyme Engineering: Serves as a template for improving redox enzyme stability and activity .

  3. Industrial Biosynthesis: Compatible with P. putida’s metabolic engineering platforms for producing value-added chemicals .

Advantages Over Native Enzymes

  • Stability: Recombinant YedZ retains activity under high osmolarity and solvent stress .

  • Scalability: High-yield production in E. coli (≥1 mg/mL) reduces reliance on native P. putida systems .

Challenges and Future Directions

  • Functional Heterogeneity: Variability in heme incorporation efficiency across expression batches .

  • Optimization Needs: Enhanced solubility and folding in non-native hosts (e.g., E. coli) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
msrQ; Pput_4539; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)
Target Names
msrQ
Target Protein Sequence
MRYPWFRLAIFVVGCLFPVWWLYEAAMNLLGPDPGKIMMDRLGLGALTFLLVTLSMTPLQ KLTGWSGWIVVRRQLGLWVFAYIVLHILAYLFFILGLDWGQLAVELRKRPYIIVGALGFL GLLALAVTSNRYSQRRLGARWRKLHRLVYAVLGLGLLHFLWIVRSDLREWAIYAFIGAVL MVLRIPAVARALPRVARKQGRAV
Uniprot No.

Target Background

Function
YedZ, part of the MsrPQ system, plays a crucial role in repairing oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) using respiratory chain electrons. This repair mechanism protects these proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated by host defense mechanisms. MsrPQ is essential for maintaining envelope integrity under bleach stress, rescuing a wide range of structurally diverse periplasmic proteins from methionine oxidation. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.
Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional relationship between YedZ and YedY in Pseudomonas putida?

YedZ functions as a heme-binding membrane protein subunit that works in coordination with YedY, a soluble periplasmic molybdoenzyme with methionine sulfoxide reductase activity. Together, they form a system involved in hypochlorite scavenging and defense against reactive chlorine species (RCS). The YedY component has been biochemically characterized to reduce free methionine sulfoxide in vitro, suggesting its physiological role as a reductase rather than an oxidase . The YedZ component likely serves as an electron transfer partner that supports the redox activity of YedY. This system appears to be part of a coordinated stress response mechanism that helps bacterial cells withstand oxidative challenges, particularly from hypochlorite and related compounds .

How is the YedY/YedZ system regulated in bacterial cells?

The YedY/YedZ system appears to be specifically regulated in response to reactive chlorine species. Research has identified that a sigma/anti-sigma factor system (SigF/NrsF) is activated specifically by RCS and initiates transcription of a small regulon that includes yedY and mrpX (a methionine-rich periplasmic protein) . Importantly, transcriptomic studies have shown upregulation of yedYZ in response to hypochlorite but not hydrogen peroxide in E. coli O157:H7, demonstrating specificity to chlorine-based oxidative stress . Additional evidence from chlorate-reducing bacteria showed transcriptional upregulation of yedYZ homologs under chlorate-respiring conditions, further supporting its role in responding to chlorine compounds .

What is the phylogenetic distribution of the YedZ protein across bacterial species?

The YedY/YedZ system shows a wide but uneven distribution across bacterial phyla. Analysis across more than 2,000 microbial genomes revealed that YedY is widely distributed among bacteria but is most prevalent in Proteobacteria . The genes are frequently found adjacent to MrpX and SigF/NrsF but are also linked to canonical methionine sulfoxide reductases msrA and msrB in some organisms . Certain variants of YedY appear to be enriched in host-associated organisms, including uropathogenic E. coli (UPEC), Brucella species, and members of the Rhizobiales, suggesting potential roles in host-pathogen interactions or adaptation to specific environmental niches .

What expression systems are most effective for recombinant production of YedZ in Pseudomonas putida?

For effective recombinant expression of membrane proteins like YedZ in P. putida, researchers should consider the following methodological approaches:

Expression System ComponentRecommended ApproachRationale
Promoter selectionStrong, inducible promoters with tight regulationP. putida has shown that the choice of appropriate promoter is crucial for recombinant protein production
Vector systemBroad-host-range plasmids with stability elementsEnsures stable maintenance in P. putida during growth
Induction conditionsGradual induction at lower temperatures (20-25°C)Reduces inclusion body formation for membrane proteins
Growth mediaMinimal media with controlled carbon sourceP. putida's versatile metabolism allows optimization of growth conditions
Strain selectionP. putida KT2440 or derivatives with reduced proteolytic activityTakes advantage of P. putida's outstanding xenobiotic tolerance

P. putida offers several advantages as an expression host, including its versatile intrinsic metabolism with diverse enzymatic capacities and outstanding tolerance to xenobiotics . These characteristics make it particularly suitable for expressing challenging membrane proteins like YedZ, which may be toxic or difficult to express in conventional hosts.

How can functional activity of the YedY/YedZ system be measured in experimental settings?

The functional activity of the YedY/YedZ system can be assessed through multiple complementary approaches:

  • Methionine sulfoxide reduction assay: Measure the ability of purified or cellular YedY/YedZ to reduce free methionine sulfoxide or peptide-bound methionine sulfoxide. This reflects the biochemical activity observed in E. coli homologs .

  • RCS tolerance measurements: Compare growth curves of wild-type, knockout, and complemented strains when exposed to increasing concentrations of hypochlorite or chlorate. Studies have shown that mutations in yedY and yedZ lead to reduced fitness specifically under chlorite stress conditions .

  • Methionine oxidation quantification: Monitor the oxidation state of the MrpX protein (methionine-rich periplasmic protein) that works alongside YedY/YedZ, as it serves as a hypochlorite scavenger through sacrificial oxidation of its methionine residues .

  • Electron transfer measurements: Assess electron transfer capabilities using spectroscopic methods to monitor the redox state of the heme group in YedZ during functional activity.

What genetic approaches have been successful for studying YedZ function in vivo?

Genetic ApproachApplicationKey Findings
Gene deletion (knockout)Creation of single and double deletion mutantsΔyedY mutants showed fitness defects specifically in response to chlorite stress, with more severe defects in double knockouts (e.g., ΔsigF ΔyedY2)
Complementation studiesReintroduction of wild-type or mutant allelesCan determine essential residues and domains for YedZ function
Transcriptome analysis (RNA-Seq)Identify genes co-regulated with yedZRevealed that SigF regulates a small regulon including yedY1 and mrpX
Chemogenomic profilingFitness profiling of barcoded transposon poolsDemonstrated that yedYZ were dispensable for hundreds of conditions, with the notable exception of chlorite stress
Regulatory element analysisIdentification of promoter regions and binding sitesHelped establish the role of SigF as a regulator activated specifically by RCS

What is the molecular mechanism of hypochlorite scavenging by the YedY/YedZ/MrpX system?

The current evidence suggests a sophisticated molecular mechanism for hypochlorite scavenging involving multiple coordinated components:

  • Initial detection: The SigF/NrsF sigma/anti-sigma factor system specifically detects reactive chlorine species (RCS) .

  • Transcriptional activation: Upon activation, SigF initiates transcription of a small regulon centered around yedY1 and mrpX .

  • Hypochlorite scavenging: The methionine-rich periplasmic protein (MrpX) acts as a primary scavenger, becoming strongly induced and rapidly oxidized by RCS, especially hypochlorite. This involves sacrificial oxidation of methionine residues in MrpX in the periplasm .

  • Regeneration cycle: The oxidized MrpX is regenerated through reduction by the YedY methionine sulfoxide reductase activity, returning the system to its active state .

  • Electron transfer: YedZ likely functions as an electron transfer component, using its heme group to shuttle electrons to support the reductive activity of YedY.

This integrative system provides an efficient mechanism for detecting, neutralizing, and recovering from hypochlorite stress, with redundant pathways ensuring robust protection against RCS.

How do paralogous YedY/YedZ systems contribute to oxidative stress resistance?

Research has identified interesting functional relationships between paralogous systems that contribute to oxidative stress resistance:

  • Redundant pathways: Studies revealed that some bacteria possess multiple yedY paralogs (e.g., yedY1 and yedY2), which appear to provide redundant pathways for ameliorating RCS stress .

  • Differential regulation: While yedY1 is regulated by SigF in response to RCS, yedY2 is not regulated by RCS or SigF but plays a critical role in providing a redundant system for limiting RCS stress .

  • Synergistic effects: Experimental evidence demonstrated synergistic relationships between these systems. For example, a ΔsigF ΔyedY2 double mutant exhibited a very strong growth defect with chlorate, with the severity proportional to chlorate concentration and no growth at 20 mM chlorate. This defect was more severe than in a ΔsigF ΔyedY1 mutant .

  • Regulatory independence: The research revealed that the yedY2 gene provides an important background level of protection independent of stress-induced regulation, offering a complementary layer of defense .

This complex network of paralogous systems with both overlapping and distinct roles highlights the evolutionary importance of RCS resistance in bacterial survival.

What are the structural determinants of substrate specificity in YedY?

While the search results don't provide specific structural information about YedY from P. putida, research on homologs suggests several important considerations for understanding substrate specificity:

  • Stereoselectivity: A key question for YedY function is its stereoselectivity toward methionine sulfoxide, which exists as R and S diastereomers. Future biochemical studies should investigate whether YedY exhibits preference for specific stereoisomers .

  • Substrate preference: Another critical aspect is YedY's preference for free methionine sulfoxide versus peptide-bound methionine sulfoxide. This determines whether it primarily functions in recycling oxidized free methionine or in repairing oxidatively damaged proteins .

  • Active site architecture: The molybdenum-containing active site of YedY likely contains specific residues that determine substrate binding and catalysis. Structural studies would be needed to identify these key residues.

  • Heme interaction interface: The interaction between YedY and its partner YedZ would involve an interface for electron transfer from the heme-containing YedZ to the catalytic site of YedY.

How can researchers address inconsistent YedZ expression levels in recombinant systems?

When working with recombinant YedZ in P. putida, researchers may encounter variable expression levels due to several factors. The following troubleshooting approaches are recommended:

  • Optimize codon usage: Adjust codon usage to match P. putida preferences, as Pseudomonas species have distinctive codon biases that can affect translation efficiency.

  • Balance metabolic flux: P. putida has a versatile intrinsic metabolism with diverse enzymatic capacities , which can sometimes divert resources away from recombinant protein production. Consider deleting competing pathways (similar to the approach used with PHA pathway in rhamnolipid production) .

  • Monitor growth parameters: P. putida's growth characteristics can affect recombinant protein yields. Ensure consistent culture conditions, as P. putida's metabolic versatility can lead to variable growth patterns depending on media composition.

  • Consider membrane protein toxicity: As a membrane protein, overexpression of YedZ may disrupt membrane integrity. Use titratable promoters and lower induction levels if toxicity is observed.

  • Optimize extraction methods: Membrane proteins require specialized extraction protocols. Optimize detergent selection and solubilization conditions specific to YedZ to ensure consistent recovery from the membrane fraction.

What approaches can help reconcile contradictory findings about YedZ function across different bacterial species?

When investigating YedZ function, researchers may encounter apparently contradictory findings across different bacterial species. Several approaches can help resolve these discrepancies:

  • Phylogenetic context analysis: YedY is widely distributed among bacteria but most prevalent in Proteobacteria . Create phylogenetic trees of YedZ/YedY sequences to determine if functional differences correlate with evolutionary distance.

  • Experimental standardization: Develop standardized assay conditions for measuring YedZ/YedY activity across species to enable direct comparisons.

  • Domain swapping experiments: Engineer chimeric proteins containing domains from different species to identify regions responsible for functional differences.

  • Context-dependent regulation analysis: Examine whether differences in regulatory networks (such as the SigF regulon) might explain functional disparities between species .

  • Bayesian experimental design: Apply Bayesian optimal experimental design principles to efficiently test competing hypotheses about YedZ function. This approach minimizes the expected posterior entropy by selecting experiments that yield maximum information .

How might engineered YedZ variants enhance RCS tolerance in synthetic biology applications?

Engineered YedZ variants could potentially enhance bacterial tolerance to reactive chlorine species in several ways:

What role might the YedY/YedZ system play in host-microbe interactions for pathogenic and beneficial bacteria?

The enrichment of certain YedY variants in host-associated organisms such as uropathogenic E. coli, Brucella species, and members of the Rhizobiales suggests important roles in host-microbe interactions :

  • Pathogen persistence: The YedY/YedZ system may contribute to bacterial survival in host environments where hypochlorite and other RCS are used as antimicrobial defense mechanisms.

  • Symbiotic relationships: In beneficial relationships (such as Rhizobiales with plants), the system might protect bacteria during initial colonization when hosts may deploy RCS as part of their screening of potential symbionts.

  • Biofilm protection: The system could provide protection for bacteria within biofilms, where localized oxidative stress may occur.

  • Experimental approaches: Researchers could use the Bayesian optimal experimental design approach to efficiently test these hypotheses, selecting interventions that yield maximum information about the causal structure of host-microbe interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.