Recombinant Pseudomonas putida Type 4 fimbrial assembly protein PilC (pilC)

Shipped with Ice Packs
In Stock

Description

Introduction

The pilC gene encodes the Type 4 fimbrial assembly protein PilC in Pseudomonas putida. PilC is an accessory protein essential for assembling pilin subunits into pili . Type IV pili (T4P) are thin, flexible filaments found on the surface of gram-negative bacteria and play a role in various processes, including cell adsorption, biofilm formation, and twitching motility .

Characteristics of PilC

PilC is located in the outer membrane and has a conserved C-terminal region of unknown function . PilC is part of the PilC-PilE operon that shows similarity to PilC from Neisseria gonorrhoeae and PilY1 from Pseudomonas aeruginosa .

  • Species: Pseudomonas putida (Arthrobacter siderocapsulatus)

  • Protein Names: Type 4 fimbrial assembly protein PilC

  • Gene Names: pilC

  • Uniprot NO.: P36641

  • Expression Region: 1-401

  • AA Sequence: MNPSIRLYAWQGTNADGLAVSGQMAGRSPAYVRAGLLRQGILVARLRPAGRAWRWPKRREKTDPAGFSRQLATLLKAGVPLLQAFEVMGRSGCDAAQAALLARLKQDVASGLGLADALQRHPGWFDTLYCNLVRVGEQSGTLDRQLEQLAGMLEQRLALHKKLRKAMIYPLLLLLTGLGVSAVLLLEVIPQFQSLFAGFDAALPAFTQWVIDLSTGLGRHAPVLLVSAVLLAVAARELYRKHRPARLWITQRVLGLPVFGKLLGQAALARFARSLATSYAAGVPLLDALGTVAKASGGELHQQAIQRLRQGMANGQGLNQAMAAEPLFPPLLVQLVAIGESSGTLDQMLEKAASHYEEQVSQALDQLTSLLEPAIVLVLGLLVGGLVVAMYLPIFQLGSLI

Function of PilC

PilC is involved in the translocation of the type IV pilin (PilA) . It is required for type IV fimbrial assembly .

Role in Type IV Fimbrial Biogenesis

PilC is homologous to PilC from N. gonorrhoeae and PilY1 from P. aeruginosa. Many homologous genes in Pseudomonas and Neisseria species are clustered at a single locus but with different genetic organizations .

In Dichelobacter nodosus, mutation of pilC results in unstable fimbriae production. Initial pilC mutants show reduced levels of fimbriae but frequently switch to a nonfimbriate state upon further subculture. It was concluded that the pilC mutants are unstable .

Genetic Context

In Pseudomonas putida, the pilC gene is found next to pilD (xcpA) and pilA, which are highly homologous to genes involved in the biogenesis of type IV pili . The pilA gene encodes the pilin subunit. Unlike P. aeruginosa, the pilB gene is lacking in the P. putida gene cluster .

Involvement in Protease Secretion

Homologs of PilC, such as FimN, FimO, and FimP, are required for the secretion of unrelated extracellular proteins in Dichelobacter nodosus, a type IV fimbriate bacterium . Mutants of fimN, fimO, fimP, and pilE exhibit significantly reduced extracellular protease activity .

Table Summarizing Key Findings

FeatureDescription
Gene NamepilC
Protein NameType 4 fimbrial assembly protein PilC
FunctionRequired for the assembly of pilin subunits into pili, involved in the translocation of the type IV pilin (PilA)
HomologsPilC from Neisseria gonorrhoeae and PilY1 from Pseudomonas aeruginosa, FimN, FimO, and FimP
Genetic ContextLocated next to pilD (xcpA) and pilA in Pseudomonas putida.
Dichelobacter nodosuspilC mutants are unstable and switch to a nonfimbriate state. FimN, FimO, FimP, and PilE are involved in extracellular protease secretion.
ExpressionPili were not detected on the cell surface of P. putida itself, even when pilA was expressed from the tac promoter on a plasmid, indicating that not all the genes required for pilus biogenesis were expressed .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. To prioritize a specific tag, please inform us during your order.
Synonyms
pilC; Type 4 fimbrial assembly protein PilC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-401
Protein Length
full length protein
Species
Pseudomonas putida (Arthrobacter siderocapsulatus)
Target Names
pilC
Target Protein Sequence
MNPSIRLYAWQGTNADGLAVSGQMAGRSPAYVRAGLLRQGILVARLRPAGRAWRWPKRRE KTDPAGFSRQLATLLKAGVPLLQAFEVMGRSGCDAAQAALLARLKQDVASGLGLADALQR HPGWFDTLYCNLVRVGEQSGTLDRQLEQLAGMLEQRLALHKKLRKAMIYPLLLLLTGLGV SAVLLLEVIPQFQSLFAGFDAALPAFTQWVIDLSTGLGRHAPVLLVSAVLLAVAARELYR KHRPARLWITQRVLGLPVFGKLLGQAALARFARSLATSYAAGVPLLDALGTVAKASGGEL HQQAIQRLRQGMANGQGLNQAMAAEPLFPPLLVQLVAIGESSGTLDQMLEKAASHYEEQV SQALDQLTSLLEPAIVLVLGLLVGGLVVAMYLPIFQLGSLI
Uniprot No.

Target Background

Function

Function: Involved in the translocation of type IV pilin (PilA).

Protein Families
GSP F family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is PilC and what role does it play in Type 4 pili assembly?

PilC is an inner membrane protein that serves as a critical component of the Type 4 pili (T4P) assembly machinery in Pseudomonas putida. It functions as part of the inner membrane platform that anchors the assembly apparatus and facilitates the transfer of pilin subunits from the inner membrane to the growing pilus fiber. As a core component of the T4P system, PilC works in coordination with the assembly ATPase PilB and other proteins to enable proper pilus extension.

The assembly of T4P requires multiple proteins spanning the bacterial cell envelope, with PilC positioned in the inner membrane acting as a bridge between cytoplasmic components and the secretion channel . The gene encoding PilC is typically found in a cluster with other T4P assembly genes including pilB and pilD, highlighting its integrated role in the assembly process .

To properly study PilC function, researchers must consider its interactions with other components of the T4P system, particularly the energy-providing ATPases that power assembly (PilB) and retraction (PilT), as well as regulatory proteins like FimX that coordinate these activities in response to environmental signals .

What experimental approaches are most effective for studying native PilC function?

Multiple complementary approaches are required to comprehensively study native PilC function. These include:

  • Genetic manipulation techniques: Gene deletion and complementation studies are fundamental for establishing the role of PilC. Creating clean deletion mutants of pilC followed by phenotypic characterization helps establish its function, while complementation with wild-type or mutated versions can identify critical domains.

  • Phenotypic assays: Twitching motility assays on semi-solid surfaces provide a direct measure of T4P functionality. PilC mutants typically show reduced or abolished twitching compared to wild-type strains due to impaired pilus assembly .

  • Protein localization studies: Fluorescence microscopy using PilC-fluorescent protein fusions helps determine its subcellular localization. Similar to observations with other T4P components, functional PilC typically localizes to the bacterial pole where pilus assembly occurs .

  • Interaction studies: Co-immunoprecipitation or bacterial two-hybrid assays can identify interactions between PilC and other T4P components. This approach has revealed important interactions between assembly components in related systems, such as between FimX and PilB in P. aeruginosa .

How is the pilC gene organized in Pseudomonas putida compared to other Pseudomonads?

The pilC gene in Pseudomonas putida is typically located within a conserved gene cluster containing other T4P assembly components. Based on genomic analyses, the organization follows a pattern similar to other Pseudomonads, though with some species-specific variations:

SpeciesGene OrganizationNotable Features
P. putidaPart of operon with pilB and pilDUnidirectional orientation common in environmental strains
P. aeruginosaClustered with pilB (pilF) and pilDWell-characterized with associated motility phenotypes
Other PseudomonadsVariable arrangements with core T4P genesSpecies-specific regulatory elements

The pilC gene in P. putida is sometimes referred to as pilG in the literature, which can create confusion . Genomic context analysis reveals that the core T4P assembly genes (pilB, pilC, pilD) are typically co-transcribed, suggesting coordinated expression of these functionally related proteins . Comparing the genomic organization across Pseudomonas species provides insights into evolutionary conservation and specialization of T4P systems in different environmental niches.

How do regulatory proteins like FimX coordinate with PilC for controlled T4P assembly?

The regulation of T4P assembly in Pseudomonas species involves complex interactions between regulatory proteins like FimX and core assembly components including PilC. FimX, a cyclic-di-GMP binding protein, plays a crucial role in this process through several mechanisms:

  • Polar localization dependence: FimX localizes to the leading pole of twitching bacteria, and this localization requires both T4P assembly machine proteins and the assembly ATPase PilB. This suggests a spatial coordination mechanism where FimX brings regulatory signals to the assembly apparatus that includes PilC .

  • Protein-protein interactions: Research in P. aeruginosa has demonstrated that FimX directly interacts with PilB both in vivo and in vitro. This interaction is dependent on FimX's ability to bind cyclic-di-GMP, suggesting a regulatory cascade where environmental signals modify cyclic-di-GMP levels, affecting FimX-PilB interactions and subsequently the activity of the PilC-containing assembly complex .

  • Assembly promotion mechanism: FimX positively regulates T4P assembly not by stabilizing assembled pili or preventing retraction, but by specifically promoting the activity of the PilB ATPase. This regulation ultimately affects how PilC functions within the assembly machinery .

This sophisticated regulatory network allows bacteria to coordinate T4P assembly in response to environmental cues, with PilC serving as part of the core machinery that responds to these regulatory inputs. Researchers studying PilC function must consider these interactions to fully understand its role in the broader context of T4P dynamics.

What methodological challenges exist in expressing and purifying recombinant PilC?

Recombinant production of membrane proteins like PilC presents several specific challenges that researchers must address:

  • Membrane protein solubility: As an integral membrane protein, PilC is hydrophobic and difficult to express in soluble form. Researchers often need to optimize expression systems, including:

    • Fusion tags that enhance solubility (MBP, SUMO, etc.)

    • Specialized E. coli strains designed for membrane protein expression

    • Controlled expression conditions with reduced induction temperatures (20-25°C) to allow proper folding

  • Expression host selection: While E. coli is commonly used, expression in Pseudomonas hosts may provide advantages for proper folding and post-translational modifications. The method described for prodigiosin production in P. putida using random chromosomal integration could be adapted for PilC expression .

  • Purification strategy optimization: Effective purification typically requires:

    • Careful membrane extraction using detergents optimized for PilC stability

    • Multi-step chromatography approaches

    • Quality control to ensure protein functionality is maintained

  • Functional validation: Confirming that recombinant PilC retains native structure and function is crucial, requiring complementation assays in pilC-deficient strains to verify functionality.

The table below summarizes optimization strategies for recombinant PilC production:

ChallengeStrategyOutcome Measurement
Low expression levelsTest multiple promoters; optimize codon usageQuantitative western blot
Protein insolubilityScreen detergents; use fusion tagsSolubility assays
Improper foldingReduce expression temperature to 20°C; co-express chaperonesCircular dichroism spectroscopy
Functional assessmentComplementation of pilC mutantsTwitching motility restoration

How do mutations in different PilC domains affect T4P assembly and function?

Structure-function analysis of PilC through targeted mutagenesis has revealed domain-specific roles in T4P assembly and function:

  • Transmembrane domains: Mutations in the transmembrane helices often completely abolish function, as they are essential for proper membrane integration and maintaining the structural integrity of the assembly platform. These mutations typically result in complete loss of surface pili and twitching motility.

  • Cytoplasmic domains: The cytoplasmic regions of PilC interact with the assembly ATPase PilB. Targeted mutations in these interaction interfaces reduce but do not eliminate pilus assembly, resulting in decreased twitching motility. This suggests these domains play roles in optimizing assembly efficiency rather than being absolutely required.

  • Periplasmic domains: These regions likely interact with other components of the assembly machinery spanning the periplasm. Mutations here can result in assembled but non-functional pili, indicating a role in coordinating proper pilus formation and extension.

A systematic approach to studying these mutations involves:

  • Creating a library of domain-specific PilC mutants

  • Assessing surface piliation through immunofluorescence microscopy

  • Measuring twitching motility using standardized agar plate assays

  • Examining protein-protein interactions through co-immunoprecipitation or bacterial two-hybrid assays

What protocols are most effective for recombinant production of PilC in Pseudomonas putida?

Based on successful approaches with other recombinant proteins in P. putida, the following optimized protocol is recommended for PilC production:

  • Vector construction and gene integration:

    • Clone the pilC gene into a vector containing appropriate regulatory elements

    • Consider the TREX system which enables random chromosomal integration via transposition

    • Include a selection marker such as gentamycin resistance for identifying transformants

  • Host strain selection and transformation:

    • Use P. putida KT2440 as a well-characterized host with a fully sequenced genome

    • Employ conjugation-based transfer from E. coli S17-1 as described for the prodigiosin gene cluster

    • Select transformants on LB medium supplemented with appropriate antibiotics

  • Optimized culture conditions:

    • Use rich medium (LB) with 1/10 filling volume/flask capacity ratio

    • Incubate at lower temperatures (20-30°C) to enhance proper folding

    • Maintain high aeration conditions with constant shaking (120 rpm)

  • Extraction and purification:

    • Develop a fast and effective protocol for membrane fraction isolation

    • Use appropriate detergents for membrane protein solubilization

    • Employ affinity chromatography targeting an engineered tag on PilC

ParameterRecommended ConditionRationale
Culture temperature20°CSlower expression promotes proper folding
MediumLB or defined mediumRich nutrients support membrane protein production
AerationHigh (120 rpm, low volume/flask ratio)Ensures adequate oxygen for cell growth and protein folding
Induction timingMid-log phase (OD600 0.6-0.8)Balances biomass and expression efficiency
Extraction buffer50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 1% DDMPreserves protein structure during solubilization

This protocol draws on principles established for other recombinant proteins in P. putida, adapting them to address the specific challenges of PilC as a membrane protein .

How can researchers effectively study the interaction between PilC and other T4P assembly components?

Investigating protein-protein interactions involving PilC requires multiple complementary approaches:

  • In vivo interaction studies:

    • Bacterial two-hybrid (BTH) assays: Fusion of PilC domains to T18/T25 fragments of adenylate cyclase can identify interactions with other T4P components

    • Split fluorescent protein complementation: Fusion of potential interaction partners to complementary fragments of a fluorescent protein enables visualization of interactions in living cells

    • Co-immunoprecipitation: Using antibodies against PilC or epitope-tagged versions to pull down interaction partners, followed by mass spectrometry identification

  • In vitro interaction characterization:

    • Surface plasmon resonance (SPR): Measures binding kinetics between purified PilC and potential partners

    • Isothermal titration calorimetry (ITC): Quantifies thermodynamic parameters of interactions

    • Microscale thermophoresis (MST): Detects interactions by measuring changes in thermophoretic movement upon binding

  • Structural approaches:

    • Cross-linking coupled with mass spectrometry: Identifies specific residues involved in protein-protein interactions

    • Cryo-electron microscopy: Visualizes larger complexes containing PilC and interaction partners

These approaches can be applied to study interactions between PilC and other key components like PilB, which has been shown to interact with regulatory proteins like FimX in P. aeruginosa . When designing these experiments, it's important to consider the membrane-embedded nature of PilC and to include appropriate controls for specificity.

What are the best techniques for analyzing PilC localization and dynamics in vivo?

Multiple advanced microscopy and biochemical techniques can be employed to study PilC localization and dynamics:

  • Fluorescent protein fusions:

    • C-terminal or internal fusions that preserve function

    • Super-resolution microscopy (PALM/STORM) to overcome diffraction limits

    • Time-lapse microscopy to capture dynamic redistribution during twitching

  • Photoactivatable and photoconvertible tags:

    • Enables tracking of specific subpopulations of PilC molecules

    • Pulse-chase experiments to determine protein turnover rates

    • FRAP (Fluorescence Recovery After Photobleaching) to measure diffusion rates within the membrane

  • Subcellular fractionation and biochemical analysis:

    • Separate membrane fractions to quantify PilC distribution

    • Protease accessibility assays to determine protein topology

    • Density gradient centrifugation to associate PilC with specific membrane microdomains

The experimental design should include proper controls to ensure that fluorescent tags don't disrupt function, such as complementation assays in pilC-deficient strains to verify that tagged proteins retain functionality. Based on studies of related T4P components, PilC likely exhibits polar localization similar to what has been observed for FimX and PilB in P. aeruginosa .

How should researchers interpret contradictory data regarding PilC function?

When faced with contradictory data regarding PilC function, researchers should apply a systematic analytical approach:

  • Strain background considerations:

    • Different P. putida strains may have variations in their T4P systems

    • Laboratory strains versus environmental isolates may exhibit different phenotypes

    • Genetic background effects may influence experimental outcomes

  • Methodological variations analysis:

    • Standardize experimental conditions across laboratories

    • Consider differences in growth conditions that affect T4P expression

    • Evaluate the sensitivity and specificity of different assays used to measure T4P function

  • Multiple phenotype assessment:

    • Examine both direct measures (surface piliation, protein expression) and indirect measures (twitching motility, biofilm formation)

    • Correlate genotype with multiple phenotypic readouts

    • Use complementation studies to verify that observed phenotypes are specifically due to pilC mutations

  • Contextual protein interactions:

    • Consider that contradictions may arise from unrecognized interactions with other proteins

    • Evaluate whether regulatory proteins like FimX affect experimental outcomes

    • Assess whether differences in cyclic-di-GMP levels could impact results

A particularly effective approach is to create a comprehensive data table that compares conflicting findings across different studies, examining variables like strain backgrounds, experimental conditions, and measurement techniques. This structured comparison often reveals patterns that explain apparent contradictions.

What statistical approaches are most appropriate for analyzing PilC-related experimental data?

  • For twitching motility assays:

    • ANOVA with post-hoc tests for comparing multiple strains/conditions

    • Mixed-effects models when dealing with repeated measures over time

    • Non-parametric alternatives (Kruskal-Wallis) when normality assumptions are violated

  • For protein-protein interaction studies:

    • Curve fitting for binding kinetics data (e.g., from SPR)

    • Bootstrap resampling to estimate confidence intervals

    • Background correction methods for co-immunoprecipitation quantification

  • For microscopy and localization data:

    • Image analysis workflows with appropriate controls

    • Intensity correlation analysis for co-localization studies

    • Track analysis algorithms for dynamic studies

  • General considerations:

    • Sample size determination through power analysis before experiments

    • Appropriate transformations for data that violates parametric assumptions

    • Multiple testing corrections (e.g., Bonferroni, FDR) when performing many comparisons

The table below provides guidance on statistical methods for common PilC experimental designs:

Experimental ApproachRecommended Statistical MethodSample Size RecommendationData Presentation Format
Twitching motility comparisonOne-way ANOVA with Tukey's post-hocn ≥ 5 biological replicatesBox plots with individual data points
Protein interaction strengthNon-linear regression for Kd determination3 independent experiments with technical triplicatesBinding curves with 95% confidence intervals
Protein localizationFrequency distribution analysisn ≥ 100 cells per conditionHeat maps or violin plots
Gene expression analysisStudent's t-test or Mann-Whitney U testn ≥ 3 biological replicatesBar graphs with error bars representing standard deviation

How can structural biology approaches advance our understanding of PilC function?

Structural characterization of PilC represents a significant opportunity to advance understanding of T4P assembly:

  • Cryo-electron microscopy approaches:

    • Single particle analysis of purified PilC complexes

    • Subtomogram averaging of the assembled T4P machinery in situ

    • Visualization of conformational changes during the assembly cycle

  • X-ray crystallography and NMR spectroscopy:

    • Crystallization of soluble domains for high-resolution structural information

    • Solution NMR for dynamics studies of isolated domains

    • Identification of critical residues for mutagenesis studies

  • Integrative structural biology:

    • Combining multiple techniques (EM, X-ray, mass spectrometry)

    • Molecular dynamics simulations based on experimentally determined structures

    • Computational prediction of interaction interfaces

The resulting structural information would provide critical insights into how PilC participates in pilus assembly, potentially revealing conformational changes associated with the extension and retraction cycle. This knowledge could guide the design of targeted mutations to test specific mechanistic hypotheses about PilC function.

What emerging technologies could reshape our approach to studying PilC?

Several cutting-edge technologies offer promising new approaches to study PilC:

  • CRISPR-Cas9 genome editing:

    • Precise modification of the native pilC gene with minimal disruption

    • Introduction of fluorescent tags at the endogenous locus

    • Creation of conditional knockdowns for essential functions

  • Single-molecule techniques:

    • FRET-based approaches to measure conformational changes

    • Optical tweezers to measure forces involved in pilus extension/retraction

    • Super-resolution microscopy to visualize individual PilC molecules

  • Microfluidics and live-cell imaging:

    • Real-time observation of twitching motility under controlled conditions

    • Rapid environmental changes to study dynamic responses

    • Single-cell analysis of PilC localization and function

  • Computational approaches:

    • Machine learning for image analysis and phenotype prediction

    • Systems biology models integrating PilC into broader signaling networks

    • Molecular simulations of PilC within membrane environments

These emerging technologies promise to provide unprecedented insights into the dynamic function of PilC in living cells, potentially revealing aspects of its role that have been inaccessible to conventional approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.